Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1532
Gene name
Locationscaffold_155:223..950
Strand+
Gene length (bp)727
Transcript length (bp)669
Coding sequence length (bp)666
Protein length (aa) 222

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02301 HORMA HORMA domain 6.2E-06 18 163

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0E7J8|REV7_SCHPO DNA polymerase zeta processivity subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev7 PE=3 SV=1 12 220 2.0E-26
sp|Q568H3|MD2L2_DANRE Mitotic spindle assembly checkpoint protein MAD2B OS=Danio rerio GN=mad2l2 PE=2 SV=1 18 220 2.0E-10
sp|Q4KWZ6|MD2L2_CHICK Mitotic spindle assembly checkpoint protein MAD2B OS=Gallus gallus GN=MAD2L2 PE=1 SV=1 15 219 8.0E-10
sp|Q9Z1B5|MD2L1_MOUSE Mitotic spindle assembly checkpoint protein MAD2A OS=Mus musculus GN=Mad2l1 PE=1 SV=2 18 188 9.0E-10
sp|Q2KIP7|MD2L2_BOVIN Mitotic spindle assembly checkpoint protein MAD2B OS=Bos taurus GN=MAD2L2 PE=2 SV=1 18 219 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0E7J8|REV7_SCHPO DNA polymerase zeta processivity subunit OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rev7 PE=3 SV=1 12 220 2.0E-26
sp|Q568H3|MD2L2_DANRE Mitotic spindle assembly checkpoint protein MAD2B OS=Danio rerio GN=mad2l2 PE=2 SV=1 18 220 2.0E-10
sp|Q4KWZ6|MD2L2_CHICK Mitotic spindle assembly checkpoint protein MAD2B OS=Gallus gallus GN=MAD2L2 PE=1 SV=1 15 219 8.0E-10
sp|Q9Z1B5|MD2L1_MOUSE Mitotic spindle assembly checkpoint protein MAD2A OS=Mus musculus GN=Mad2l1 PE=1 SV=2 18 188 9.0E-10
sp|Q2KIP7|MD2L2_BOVIN Mitotic spindle assembly checkpoint protein MAD2B OS=Bos taurus GN=MAD2L2 PE=2 SV=1 18 219 1.0E-09
sp|Q8QFR4|MD2L2_XENLA Mitotic spindle assembly checkpoint protein MAD2B OS=Xenopus laevis GN=mad2l2 PE=1 SV=1 18 219 1.0E-09
sp|Q94FL5|REV7_ARATH DNA polymerase zeta processivity subunit OS=Arabidopsis thaliana GN=REV7 PE=2 SV=1 5 219 3.0E-09
sp|Q28H85|MD2L2_XENTR Mitotic spindle assembly checkpoint protein MAD2B OS=Xenopus tropicalis GN=mad2l2 PE=2 SV=1 18 219 3.0E-09
sp|Q556Y9|MD2L1_DICDI Mitotic spindle assembly checkpoint protein MAD2A OS=Dictyostelium discoideum GN=mad2l1-1 PE=3 SV=1 18 209 3.0E-09
sp|D3Z8D9|MD2L2_RAT Mitotic spindle assembly checkpoint protein MAD2B OS=Rattus norvegicus GN=Mad2l2 PE=2 SV=1 15 219 3.0E-09
sp|Q9D752|MD2L2_MOUSE Mitotic spindle assembly checkpoint protein MAD2B OS=Mus musculus GN=Mad2l2 PE=1 SV=2 15 219 3.0E-09
sp|Q9UI95|MD2L2_HUMAN Mitotic spindle assembly checkpoint protein MAD2B OS=Homo sapiens GN=MAD2L2 PE=1 SV=2 18 219 8.0E-09
sp|Q9LU93|MAD2_ARATH Mitotic spindle checkpoint protein MAD2 OS=Arabidopsis thaliana GN=MAD2 PE=1 SV=1 8 188 8.0E-08
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.5

Transmembrane Domains

Domain # Start End Length
1 10 32 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1532
MQVPSSQATALISSFGAFLTIAIHTILYHRSLYPRSSFLLARAYNLPVRQSRHPAVCGWVRDAVAAVTLELRRAA
VRRVVLSVHEPGRHRLVLERWVFDLDGFPAESLPPPPGEMMGLPLEAAEEAGVVNWDDVHQSWRAALHALALRAD
MLPPTPEDCSFALALELRLDAKPPTRHPQLWIPSEPQLQPPSGPALPTGSTVPVRSVQAGPMFFECWLERAE
Coding >Ophio5|1532
ATGCAAGTCCCCAGCTCCCAAGCGACAGCCCTCATCTCCTCCTTCGGCGCCTTCCTCACCATCGCCATCCACACC
ATCCTCTACCATCGCAGCCTCTACCCACGCAGCAGCTTCCTGCTAGCGCGCGCCTACAATCTCCCCGTGCGCCAA
TCGCGTCATCCGGCCGTATGCGGCTGGGTTCGCGACGCCGTCGCCGCCGTGACGCTTGAGCTTCGTCGCGCCGCC
GTCCGTCGGGTCGTGCTCTCGGTTCATGAACCGGGTCGTCATAGGCTTGTGCTCGAGCGTTGGGTCTTTGATCTT
GATGGCTTCCCCGCCGAATCCCTTCCCCCCCCCCCTGGCGAGATGATGGGTCTTCCCCTCGAGGCTGCTGAGGAA
GCTGGGGTCGTGAATTGGGACGATGTTCATCAGTCGTGGAGGGCTGCCTTGCATGCTTTGGCTCTGAGGGCCGAC
ATGTTGCCCCCCACGCCCGAGGACTGCTCTTTTGCTCTGGCGCTGGAGTTGCGCCTCGATGCGAAGCCTCCGACA
CGACATCCTCAGCTTTGGATCCCCTCGGAGCCGCAGCTTCAACCCCCATCGGGCCCTGCTCTCCCCACCGGCTCG
ACCGTTCCCGTTCGCTCCGTCCAGGCTGGACCCATGTTCTTCGAGTGCTGGCTTGAGCGGGCCGAG
Transcript >Ophio5|1532
ATGCAAGTCCCCAGCTCCCAAGCGACAGCCCTCATCTCCTCCTTCGGCGCCTTCCTCACCATCGCCATCCACACC
ATCCTCTACCATCGCAGCCTCTACCCACGCAGCAGCTTCCTGCTAGCGCGCGCCTACAATCTCCCCGTGCGCCAA
TCGCGTCATCCGGCCGTATGCGGCTGGGTTCGCGACGCCGTCGCCGCCGTGACGCTTGAGCTTCGTCGCGCCGCC
GTCCGTCGGGTCGTGCTCTCGGTTCATGAACCGGGTCGTCATAGGCTTGTGCTCGAGCGTTGGGTCTTTGATCTT
GATGGCTTCCCCGCCGAATCCCTTCCCCCCCCCCCTGGCGAGATGATGGGTCTTCCCCTCGAGGCTGCTGAGGAA
GCTGGGGTCGTGAATTGGGACGATGTTCATCAGTCGTGGAGGGCTGCCTTGCATGCTTTGGCTCTGAGGGCCGAC
ATGTTGCCCCCCACGCCCGAGGACTGCTCTTTTGCTCTGGCGCTGGAGTTGCGCCTCGATGCGAAGCCTCCGACA
CGACATCCTCAGCTTTGGATCCCCTCGGAGCCGCAGCTTCAACCCCCATCGGGCCCTGCTCTCCCCACCGGCTCG
ACCGTTCCCGTTCGCTCCGTCCAGGCTGGACCCATGTTCTTCGAGTGCTGGCTTGAGCGGGCCGAGTGA
Gene >Ophio5|1532
ATGCAAGTCCCCAGCTCCCAAGCGACAGCCCTCATCTCCTCCTTCGGCGCCTTCCTCACCATCGCCATCCACACC
ATCCTCTACCATCGCAGCCTCTACCCACGCAGCAGCTTCCTGCTAGCGCGCGCCTACAATCTCCCCGTGCGCCAA
TCGCGTCATCCGGCCGTATGCGGCTGGGTTCGCGACGCCGTCGCCGCCGTGACGCTTGAGCTTCGTCGCGCCGCC
GTCCGTCGGGTCGTGCTCTCGGTTCATGAACCGGGTCGTCATAGGCTTGTGCTCGAGCGTTGGGTCTTTGATCTT
GATGGCTTCCCCGCCGAATCCCTTCCCCCCCCCCCTGGCGAGATGATGGGTCTTCCCCTCGAGGCTGCTGAGGAA
GCTGGGGTCGTGAATTGGGACGATGTTCATCAGTCGTGGAGGGCTGCCTTGCATGCTTTGGCTCTGAGGGCCGAC
ATGTTGCCCCCCACGCCCGAGGACTGCTCTTTTGCTCTGGCGCTGGAGTTGCGCCTCGATGCGAAGCCTCCGACA
CGAGTGAGTCCGCTGCCTACCTTCTTGAATTCTTCTTTTTTTTTTTCTCAATCCCCTTCAGCATCCTCAGCTTTG
GATCCCCTCGGAGCCGCAGCTTCAACCCCCATCGGGCCCTGCTCTCCCCACCGGCTCGACCGTTCCCGTTCGCTC
CGTCCAGGCTGGACCCATGTTCTTCGAGTGCTGGCTTGAGCGGGCCGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail