Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1523
Gene name
Locationscaffold_154:21072..22287
Strand-
Gene length (bp)1215
Transcript length (bp)1215
Coding sequence length (bp)1212
Protein length (aa) 404

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05189 RTC_insert RNA 3'-terminal phosphate cyclase (RTC), insert domain 2.3E-28 210 320
PF01137 RTC RNA 3'-terminal phosphate cyclase 3.8E-26 12 350

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 6 404 7.0E-60
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 10 351 4.0E-56
sp|Q9Y2P8|RCL1_HUMAN RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens GN=RCL1 PE=1 SV=3 10 351 1.0E-55
sp|Q2KHX8|RCL1_BOVIN RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus GN=RCL1 PE=2 SV=1 10 351 2.0E-54
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 8 403 8.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08096|RCL1_YEAST RNA 3'-terminal phosphate cyclase-like protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RCL1 PE=1 SV=1 6 404 7.0E-60
sp|Q9JJT0|RCL1_MOUSE RNA 3'-terminal phosphate cyclase-like protein OS=Mus musculus GN=Rcl1 PE=2 SV=1 10 351 4.0E-56
sp|Q9Y2P8|RCL1_HUMAN RNA 3'-terminal phosphate cyclase-like protein OS=Homo sapiens GN=RCL1 PE=1 SV=3 10 351 1.0E-55
sp|Q2KHX8|RCL1_BOVIN RNA 3'-terminal phosphate cyclase-like protein OS=Bos taurus GN=RCL1 PE=2 SV=1 10 351 2.0E-54
sp|Q09870|RCL1_SCHPO Probable RNA 3'-terminal phosphate cyclase-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC12G12.06c PE=3 SV=1 8 403 8.0E-50
sp|Q54S38|RCL1_DICDI Probable RNA 3'-terminal phosphate cyclase-like protein OS=Dictyostelium discoideum GN=rcl1 PE=1 SV=2 9 401 5.0E-39
sp|P56175|RCL1_DROME Probable RNA 3'-terminal phosphate cyclase-like protein OS=Drosophila melanogaster GN=Rtc1 PE=2 SV=3 10 351 3.0E-38
sp|Q9C578|RCL1_ARATH Probable RNA 3'-terminal phosphate cyclase-like protein OS=Arabidopsis thaliana GN=At5g22100 PE=2 SV=1 11 404 7.0E-38
sp|Q23400|RCL1_CAEEL Probable RNA 3'-terminal phosphate cyclase-like protein OS=Caenorhabditis elegans GN=ZK1127.5 PE=3 SV=2 8 351 5.0E-37
sp|Q2HJ88|RTCA_BOVIN RNA 3'-terminal phosphate cyclase OS=Bos taurus GN=RTCA PE=2 SV=1 24 396 3.0E-09
sp|Q4R3J0|RTCA_MACFA RNA 3'-terminal phosphate cyclase OS=Macaca fascicularis GN=RTCA PE=2 SV=1 24 396 2.0E-08
sp|O00442|RTCA_HUMAN RNA 3'-terminal phosphate cyclase OS=Homo sapiens GN=RTCA PE=1 SV=1 24 396 4.0E-08
sp|Q9D7H3|RTCA_MOUSE RNA 3'-terminal phosphate cyclase OS=Mus musculus GN=RtcA PE=1 SV=2 24 398 7.0E-08
sp|Q5R7P3|RTCA_PONAB RNA 3'-terminal phosphate cyclase OS=Pongo abelii GN=RTCA PE=2 SV=1 24 396 2.0E-06
sp|A4YEC3|RTCA_METS5 RNA 3'-terminal phosphate cyclase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=rtcA PE=3 SV=1 28 329 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1523
MSFQQGPEFLRFTGHRDLSRRLTVATLTGRPVHISKIRSSSPTNPGLAPHDVSFLRLLEAVTNGSSMQISYTGTT
ITYHPGLITGTVAGEGATDGDVILHNIPDTCTRGVTFFLLPLCLLAPFSKAHMNVRFSGPGVITSATETGDVSVD
TFRTAIVPLFGLFGIPPARIELRVLQRSCAGPGGRGGGGCVELRFASQVRLPKTLHLNRSPGRVKRIRGVAYSTG
VSASNNARMIHAAREILNAFSADIHVAAQYDQAPLVATGQAGNKRRLGIGFGLSLVAESSSAGVVYSADVAVPPS
GGVVPEEVGKRCAHQLLESVAQGGCVSHVSAGAVLILMAMGSEDVGRLRIGRDVIGTEDQLRLARDLRTFGASAW
GLRDVGDDTGDIIVSVKGTGVGSVGRKMA
Coding >Ophio5|1523
ATGTCTTTCCAGCAGGGACCCGAATTCCTGCGCTTCACCGGCCACCGCGACCTCAGCAGGCGTCTCACTGTCGCG
ACCCTCACCGGCCGTCCCGTCCACATCTCCAAGATCCGCAGCTCGTCGCCCACGAACCCGGGCCTCGCCCCCCAT
GACGTTTCCTTCCTGCGCCTTCTCGAAGCCGTCACGAATGGCAGCTCGATGCAAATCTCTTACACCGGCACCACC
ATCACGTATCATCCCGGACTGATAACGGGCACCGTCGCCGGCGAGGGCGCCACCGACGGCGACGTCATTCTGCAC
AACATTCCCGACACTTGCACGAGAGGCGTGACCTTTTTTCTACTACCGCTTTGCCTGTTGGCGCCTTTCTCTAAA
GCACACATGAACGTTCGCTTCTCGGGGCCCGGCGTCATTACATCTGCCACCGAGACGGGCGACGTCTCTGTCGAC
ACGTTCCGGACCGCTATTGTACCCCTCTTCGGCCTCTTCGGCATCCCTCCCGCGAGGATCGAGCTCAGGGTGCTG
CAACGGTCTTGCGCCGGCCCTGGTGGCCGAGGCGGCGGTGGCTGCGTCGAACTGCGATTTGCCAGCCAAGTACGA
CTGCCCAAGACGCTGCATCTGAACCGAAGCCCCGGTCGGGTCAAGAGGATAAGGGGCGTCGCTTATAGCACCGGC
GTCTCGGCGTCCAACAACGCTCGCATGATACACGCTGCTCGTGAAATCCTTAATGCCTTCAGCGCCGACATCCAT
GTCGCCGCGCAATACGATCAGGCCCCGCTGGTAGCCACCGGTCAGGCGGGTAACAAGCGGAGGCTTGGCATCGGC
TTCGGACTGAGCCTGGTGGCCGAGTCGAGCTCCGCCGGAGTCGTCTACTCGGCAGACGTGGCAGTGCCCCCATCA
GGAGGCGTTGTGCCGGAGGAAGTCGGAAAGAGATGTGCGCACCAGCTGCTGGAGTCGGTTGCCCAAGGGGGCTGC
GTGAGCCACGTTTCCGCCGGCGCCGTCTTGATCCTCATGGCCATGGGATCGGAAGATGTCGGGCGACTAAGAATA
GGCAGGGACGTCATCGGAACCGAGGACCAGTTGCGGCTTGCGAGGGACCTGCGGACATTCGGCGCGAGCGCCTGG
GGATTAAGAGACGTGGGGGACGACACGGGAGACATCATTGTTTCGGTCAAGGGGACCGGTGTCGGAAGCGTAGGT
AGGAAGATGGCA
Transcript >Ophio5|1523
ATGTCTTTCCAGCAGGGACCCGAATTCCTGCGCTTCACCGGCCACCGCGACCTCAGCAGGCGTCTCACTGTCGCG
ACCCTCACCGGCCGTCCCGTCCACATCTCCAAGATCCGCAGCTCGTCGCCCACGAACCCGGGCCTCGCCCCCCAT
GACGTTTCCTTCCTGCGCCTTCTCGAAGCCGTCACGAATGGCAGCTCGATGCAAATCTCTTACACCGGCACCACC
ATCACGTATCATCCCGGACTGATAACGGGCACCGTCGCCGGCGAGGGCGCCACCGACGGCGACGTCATTCTGCAC
AACATTCCCGACACTTGCACGAGAGGCGTGACCTTTTTTCTACTACCGCTTTGCCTGTTGGCGCCTTTCTCTAAA
GCACACATGAACGTTCGCTTCTCGGGGCCCGGCGTCATTACATCTGCCACCGAGACGGGCGACGTCTCTGTCGAC
ACGTTCCGGACCGCTATTGTACCCCTCTTCGGCCTCTTCGGCATCCCTCCCGCGAGGATCGAGCTCAGGGTGCTG
CAACGGTCTTGCGCCGGCCCTGGTGGCCGAGGCGGCGGTGGCTGCGTCGAACTGCGATTTGCCAGCCAAGTACGA
CTGCCCAAGACGCTGCATCTGAACCGAAGCCCCGGTCGGGTCAAGAGGATAAGGGGCGTCGCTTATAGCACCGGC
GTCTCGGCGTCCAACAACGCTCGCATGATACACGCTGCTCGTGAAATCCTTAATGCCTTCAGCGCCGACATCCAT
GTCGCCGCGCAATACGATCAGGCCCCGCTGGTAGCCACCGGTCAGGCGGGTAACAAGCGGAGGCTTGGCATCGGC
TTCGGACTGAGCCTGGTGGCCGAGTCGAGCTCCGCCGGAGTCGTCTACTCGGCAGACGTGGCAGTGCCCCCATCA
GGAGGCGTTGTGCCGGAGGAAGTCGGAAAGAGATGTGCGCACCAGCTGCTGGAGTCGGTTGCCCAAGGGGGCTGC
GTGAGCCACGTTTCCGCCGGCGCCGTCTTGATCCTCATGGCCATGGGATCGGAAGATGTCGGGCGACTAAGAATA
GGCAGGGACGTCATCGGAACCGAGGACCAGTTGCGGCTTGCGAGGGACCTGCGGACATTCGGCGCGAGCGCCTGG
GGATTAAGAGACGTGGGGGACGACACGGGAGACATCATTGTTTCGGTCAAGGGGACCGGTGTCGGAAGCGTAGGT
AGGAAGATGGCATAA
Gene >Ophio5|1523
ATGTCTTTCCAGCAGGGACCCGAATTCCTGCGCTTCACCGGCCACCGCGACCTCAGCAGGCGTCTCACTGTCGCG
ACCCTCACCGGCCGTCCCGTCCACATCTCCAAGATCCGCAGCTCGTCGCCCACGAACCCGGGCCTCGCCCCCCAT
GACGTTTCCTTCCTGCGCCTTCTCGAAGCCGTCACGAATGGCAGCTCGATGCAAATCTCTTACACCGGCACCACC
ATCACGTATCATCCCGGACTGATAACGGGCACCGTCGCCGGCGAGGGCGCCACCGACGGCGACGTCATTCTGCAC
AACATTCCCGACACTTGCACGAGAGGCGTGACCTTTTTTCTACTACCGCTTTGCCTGTTGGCGCCTTTCTCTAAA
GCACACATGAACGTTCGCTTCTCGGGGCCCGGCGTCATTACATCTGCCACCGAGACGGGCGACGTCTCTGTCGAC
ACGTTCCGGACCGCTATTGTACCCCTCTTCGGCCTCTTCGGCATCCCTCCCGCGAGGATCGAGCTCAGGGTGCTG
CAACGGTCTTGCGCCGGCCCTGGTGGCCGAGGCGGCGGTGGCTGCGTCGAACTGCGATTTGCCAGCCAAGTACGA
CTGCCCAAGACGCTGCATCTGAACCGAAGCCCCGGTCGGGTCAAGAGGATAAGGGGCGTCGCTTATAGCACCGGC
GTCTCGGCGTCCAACAACGCTCGCATGATACACGCTGCTCGTGAAATCCTTAATGCCTTCAGCGCCGACATCCAT
GTCGCCGCGCAATACGATCAGGCCCCGCTGGTAGCCACCGGTCAGGCGGGTAACAAGCGGAGGCTTGGCATCGGC
TTCGGACTGAGCCTGGTGGCCGAGTCGAGCTCCGCCGGAGTCGTCTACTCGGCAGACGTGGCAGTGCCCCCATCA
GGAGGCGTTGTGCCGGAGGAAGTCGGAAAGAGATGTGCGCACCAGCTGCTGGAGTCGGTTGCCCAAGGGGGCTGC
GTGAGCCACGTTTCCGCCGGCGCCGTCTTGATCCTCATGGCCATGGGATCGGAAGATGTCGGGCGACTAAGAATA
GGCAGGGACGTCATCGGAACCGAGGACCAGTTGCGGCTTGCGAGGGACCTGCGGACATTCGGCGCGAGCGCCTGG
GGATTAAGAGACGTGGGGGACGACACGGGAGACATCATTGTTTCGGTCAAGGGGACCGGTGTCGGAAGCGTAGGT
AGGAAGATGGCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail