Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1522
Gene name
Locationscaffold_154:19890..21007
Strand+
Gene length (bp)1117
Transcript length (bp)1062
Coding sequence length (bp)1059
Protein length (aa) 353

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08508 DUF1746 Fungal domain of unknown function (DUF1746) 2.0E-36 80 195

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14175|DSC4_SCHPO DSC E3 ubiquitin ligase complex subunit 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dsc4 PE=1 SV=1 77 195 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.45

Transmembrane Domains

Domain # Start End Length
1 131 153 22
2 176 198 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1522
MSDDAPPARSARNHDSPASARVGDHDFPLANEAAEARDTGSSTRSRSVSRQRRRRRSRSTKKRHPGLAKKLSFLT
HLLKSLDTVVIAELSGLYYMECSLFRFLIRSAGHFMYLTPKDEAFPIYMPATLMHVLFIFIPNIFCIISHLVSPL
PVGPDYHRGYQHGGLIVDFVGQKPPAYRLYYCLTDLVILAIQCLMLAVHTERENLRAALQTFNPVLPVAEQPTTV
SREELDAEERGVAINTSVIISDDSSGFELQPMRRSRDEAAQRSDDTAPLLPVASGGSSPVTPLSDVMASGNAIIG
QYHVLQSLRSASMGLERTAAHSLQTISYGATMAALQARQRGASARAPSPHPNR
Coding >Ophio5|1522
ATGAGCGACGATGCTCCGCCCGCTCGGTCGGCGCGAAACCACGACTCGCCTGCCAGTGCCAGGGTCGGTGACCAT
GATTTTCCTCTTGCCAACGAGGCGGCAGAAGCACGGGATACCGGCTCGTCCACCCGTTCGCGCTCCGTCTCGCGT
CAACGGCGCAGGAGGAGGAGCAGGAGCACTAAGAAACGGCACCCGGGGCTCGCCAAGAAGCTCTCGTTCCTCACT
CATCTTCTCAAGTCGCTGGACACGGTTGTCATCGCCGAATTGAGTGGCCTGTACTATATGGAGTGCTCGCTCTTC
CGGTTCCTGATTCGCTCTGCCGGTCATTTCATGTATCTGACTCCTAAAGACGAGGCCTTTCCCATATACATGCCG
GCGACCCTCATGCATGTCTTGTTCATCTTCATCCCCAACATCTTCTGTATCATTTCGCACCTCGTCAGTCCCCTG
CCTGTCGGACCCGACTATCACCGAGGATACCAACACGGGGGCCTCATCGTCGACTTCGTCGGCCAGAAACCTCCG
GCATATCGATTATACTACTGTCTCACAGACTTGGTAATCCTCGCCATTCAGTGTTTAATGCTGGCCGTGCACACG
GAGCGGGAGAACTTGCGCGCCGCCCTGCAGACTTTTAATCCTGTGCTGCCCGTCGCCGAGCAGCCCACGACCGTC
TCCCGCGAAGAATTGGACGCCGAAGAGCGTGGCGTGGCAATCAACACGTCCGTCATCATCTCCGACGACTCTTCC
GGCTTCGAGCTGCAGCCCATGAGACGTTCCCGAGACGAGGCTGCCCAGCGGAGCGACGACACGGCGCCCTTATTA
CCCGTCGCATCGGGTGGGAGTTCGCCTGTAACCCCACTTTCCGACGTCATGGCCTCGGGGAATGCCATAATCGGC
CAGTATCACGTCCTCCAGTCTTTGCGGTCCGCGTCAATGGGCCTCGAGCGGACTGCCGCTCACTCCCTCCAGACT
ATCAGCTATGGCGCGACTATGGCAGCCCTGCAGGCCCGGCAGCGAGGCGCGTCTGCGCGGGCCCCGTCTCCTCAC
CCCAACCGA
Transcript >Ophio5|1522
ATGAGCGACGATGCTCCGCCCGCTCGGTCGGCGCGAAACCACGACTCGCCTGCCAGTGCCAGGGTCGGTGACCAT
GATTTTCCTCTTGCCAACGAGGCGGCAGAAGCACGGGATACCGGCTCGTCCACCCGTTCGCGCTCCGTCTCGCGT
CAACGGCGCAGGAGGAGGAGCAGGAGCACTAAGAAACGGCACCCGGGGCTCGCCAAGAAGCTCTCGTTCCTCACT
CATCTTCTCAAGTCGCTGGACACGGTTGTCATCGCCGAATTGAGTGGCCTGTACTATATGGAGTGCTCGCTCTTC
CGGTTCCTGATTCGCTCTGCCGGTCATTTCATGTATCTGACTCCTAAAGACGAGGCCTTTCCCATATACATGCCG
GCGACCCTCATGCATGTCTTGTTCATCTTCATCCCCAACATCTTCTGTATCATTTCGCACCTCGTCAGTCCCCTG
CCTGTCGGACCCGACTATCACCGAGGATACCAACACGGGGGCCTCATCGTCGACTTCGTCGGCCAGAAACCTCCG
GCATATCGATTATACTACTGTCTCACAGACTTGGTAATCCTCGCCATTCAGTGTTTAATGCTGGCCGTGCACACG
GAGCGGGAGAACTTGCGCGCCGCCCTGCAGACTTTTAATCCTGTGCTGCCCGTCGCCGAGCAGCCCACGACCGTC
TCCCGCGAAGAATTGGACGCCGAAGAGCGTGGCGTGGCAATCAACACGTCCGTCATCATCTCCGACGACTCTTCC
GGCTTCGAGCTGCAGCCCATGAGACGTTCCCGAGACGAGGCTGCCCAGCGGAGCGACGACACGGCGCCCTTATTA
CCCGTCGCATCGGGTGGGAGTTCGCCTGTAACCCCACTTTCCGACGTCATGGCCTCGGGGAATGCCATAATCGGC
CAGTATCACGTCCTCCAGTCTTTGCGGTCCGCGTCAATGGGCCTCGAGCGGACTGCCGCTCACTCCCTCCAGACT
ATCAGCTATGGCGCGACTATGGCAGCCCTGCAGGCCCGGCAGCGAGGCGCGTCTGCGCGGGCCCCGTCTCCTCAC
CCCAACCGATGA
Gene >Ophio5|1522
ATGAGCGACGATGCTCCGCCCGCTCGGTCGGCGCGAAACCACGACTCGCCTGCCAGTGCCAGGGTCGGTGACCAT
GATTTTCCTCTTGCCAACGAGGCGGCAGAAGCACGGGATACCGGCTCGTCCACCCGTTCGCGCTCCGTCTCGCGT
CAACGGCGCAGGAGGAGGAGCAGGAGCACTAAGAAACGGCACCCGGGGCTCGCCAAGAAGCTCTCGTTCCTCACT
CATCTTCTCAAGTCGCTGGACACGGTTGTCATCGCCGAATTGAGTGGCCTGTACTATATGGAGTGAGTTAGCGGC
CCGTTGCTGCTCGCTGCCCGCGCTGACCGTCTTTACCACCAGGTGCTCGCTCTTCCGGTTCCTGATTCGCTCTGC
CGGTCATTTCATGTATCTGACTCCTAAAGACGAGGCCTTTCCCATATACATGCCGGCGACCCTCATGCATGTCTT
GTTCATCTTCATCCCCAACATCTTCTGTATCATTTCGCACCTCGTCAGTCCCCTGCCTGTCGGACCCGACTATCA
CCGAGGATACCAACACGGGGGCCTCATCGTCGACTTCGTCGGCCAGAAACCTCCGGCATATCGATTATACTACTG
TCTCACAGACTTGGTAATCCTCGCCATTCAGTGTTTAATGCTGGCCGTGCACACGGAGCGGGAGAACTTGCGCGC
CGCCCTGCAGACTTTTAATCCTGTGCTGCCCGTCGCCGAGCAGCCCACGACCGTCTCCCGCGAAGAATTGGACGC
CGAAGAGCGTGGCGTGGCAATCAACACGTCCGTCATCATCTCCGACGACTCTTCCGGCTTCGAGCTGCAGCCCAT
GAGACGTTCCCGAGACGAGGCTGCCCAGCGGAGCGACGACACGGCGCCCTTATTACCCGTCGCATCGGGTGGGAG
TTCGCCTGTAACCCCACTTTCCGACGTCATGGCCTCGGGGAATGCCATAATCGGCCAGTATCACGTCCTCCAGTC
TTTGCGGTCCGCGTCAATGGGCCTCGAGCGGACTGCCGCTCACTCCCTCCAGACTATCAGCTATGGCGCGACTAT
GGCAGCCCTGCAGGCCCGGCAGCGAGGCGCGTCTGCGCGGGCCCCGTCTCCTCACCCCAACCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail