Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1518
Gene name
Locationscaffold_154:10720..14259
Strand+
Gene length (bp)3539
Transcript length (bp)2952
Coding sequence length (bp)2949
Protein length (aa) 983

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12066 SERRATE_Ars2_N SERRATE/Ars2, N-terminal domain 1.3E-35 298 404
PF13821 DUF4187 Domain of unknown function (DUF4187) 2.9E-12 651 697

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 665 826 5.0E-18
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 654 970 2.0E-11
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 432 846 7.0E-11
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 664 879 1.0E-09
sp|A4IFB1|SRRT_BOVIN Serrate RNA effector molecule homolog OS=Bos taurus GN=SRRT PE=2 SV=1 654 970 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 665 826 5.0E-18
sp|Q60436|SRRT_CRIGR Serrate RNA effector molecule homolog (Fragment) OS=Cricetulus griseus GN=SRRT PE=2 SV=3 654 970 2.0E-11
sp|Q17FR9|SRRT_AEDAE Serrate RNA effector molecule homolog OS=Aedes aegypti GN=Ars2 PE=3 SV=1 432 846 7.0E-11
sp|Q5TUF1|SRRT_ANOGA Serrate RNA effector molecule homolog OS=Anopheles gambiae GN=Ars2 PE=3 SV=3 664 879 1.0E-09
sp|A4IFB1|SRRT_BOVIN Serrate RNA effector molecule homolog OS=Bos taurus GN=SRRT PE=2 SV=1 654 970 2.0E-09
sp|Q5R539|SRRT_PONAB Serrate RNA effector molecule homolog OS=Pongo abelii GN=SRRT PE=2 SV=1 654 970 2.0E-09
sp|Q99MR6|SRRT_MOUSE Serrate RNA effector molecule homolog OS=Mus musculus GN=Srrt PE=1 SV=1 654 970 2.0E-09
sp|Q9BXP5|SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens GN=SRRT PE=1 SV=1 654 970 3.0E-09
sp|B1H1X4|SRRTA_XENLA Serrate RNA effector molecule homolog A OS=Xenopus laevis GN=srrt-a PE=2 SV=1 432 824 7.0E-08
sp|O94326|YGK8_SCHPO Zinc finger protein C725.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC725.08 PE=1 SV=1 185 484 7.0E-07
sp|B4MR46|SRRT_DROWI Serrate RNA effector molecule homolog OS=Drosophila willistoni GN=Ars2 PE=3 SV=1 654 846 3.0E-06
sp|Q6INH5|SRRTB_XENLA Serrate RNA effector molecule homolog B OS=Xenopus laevis GN=srrt-b PE=2 SV=1 618 824 4.0E-06
sp|B4H732|SRRT_DROPE Serrate RNA effector molecule homolog OS=Drosophila persimilis GN=Ars2 PE=3 SV=1 644 825 6.0E-06
sp|Q28WQ8|SRRT_DROPS Serrate RNA effector molecule homolog OS=Drosophila pseudoobscura pseudoobscura GN=Ars2 PE=3 SV=2 644 825 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1518
MLLSSAYGGKCWKARASKYRLLQQYAKLNTVYAGKLPPLCNCTAVGADRKVMPRSVHVPHLTRAPLVAQSATAAK
LTSQFHPRAAAPPNRCRRFEPLPLPTLPPQTSARPRMISFSGAPQLAPLFFRCSDSDLHCHSTDPCRQRKESSIF
ERSNLTMWRDDSARSPSERNWGRDDRDDRTDNFYRSRSPGNERRDRRRSRSPPAVDRYEPRNRRDDRDRDNRRRI
ASPPANIDRYVPGQDSSPAALAVNPLADPARLPYQVGFSYFGEWWRLNEKVKEDKERARTGRRREPERNRSSREI
QEERDKEKTKIQAAYDAYKEELQAKMARNFVSEHKKEQWFRERYVPEVRNEVRAKINEMRRGAYTQWEQDLESGT
FDSFSLEGLPKSESNGAGGLVEKEEGETTASNEILGVGDLIPANGADIRDENQFQPTLLIKTIAPHVSRRNLEAF
CKENLGEEEGGFKWLSLSDPNPSKRYHRIGWVMLHPASEAPMPIGRAEPKDEYADEASKSPQLVSTAEKALEAIN
GKTVKDEVRGDFVCHVGVHNPPMNPRKKALWDLFSAPERIERDFLLVQRLVNRFETDYGSDFAGVLKVEEKVYDL
RNAGLLQPVALSTAPKKVKKMREVAMDEAMDDEEDTLMDEEEDDGAADDDETDDEHLLIKKKQLDLLIEYLRRVF
NFCFFCVFESDSIHELTRKCPGGHLRRPRSTLSSSARAVARASATGEPFPGKKRSDAGEEETHRLLQVLEPDSVD
LRKLGGRPVGDAVDEELAKFVKQEDEHKWRCKVPDCTKLFKEEHFWKKHVEKRHAEWLDSIRQEFELINAYVTDP
AHIAPSRTDANSNGHFPPSSGQTTTGTPRGFNLQNFSMNGNMGMPGFPMPPGGFLPMFPSMPTTGWNPMGDDRSG
GAIRRGGMGGGRGQFRTGPYDRRRGQHWDAGGGGRGRMGGSRWGDGAGGATGGPREAVQGRSLKSYEDLDQASSG
GGGGELNY
Coding >Ophio5|1518
ATGCTCCTCAGTTCCGCATACGGAGGCAAGTGCTGGAAAGCTCGCGCGTCCAAGTACAGATTGCTCCAGCAGTAC
GCAAAGTTAAACACTGTATACGCGGGAAAGCTGCCTCCACTATGTAACTGCACTGCAGTGGGTGCAGACCGCAAG
GTAATGCCACGTTCGGTACATGTTCCTCATCTCACTCGTGCACCTCTCGTTGCACAGTCAGCAACGGCCGCTAAA
CTCACTTCCCAGTTTCACCCACGCGCCGCGGCTCCACCAAATCGCTGCCGTCGATTCGAGCCTCTCCCTCTTCCA
ACTCTTCCTCCCCAAACCTCCGCTCGTCCACGCATGATCTCGTTCAGCGGCGCGCCACAGCTCGCGCCGCTTTTC
TTTCGCTGCTCTGATAGCGACCTTCATTGCCACAGTACAGATCCCTGCCGTCAACGCAAAGAGAGCTCGATTTTT
GAGCGTTCAAACCTCACCATGTGGCGTGACGACTCGGCGAGATCGCCCTCGGAGCGAAACTGGGGTCGTGACGAT
CGCGATGACCGAACCGATAATTTTTATCGTTCCAGATCGCCAGGAAATGAACGGAGAGATCGCCGACGTTCCCGC
TCACCACCCGCCGTCGATCGGTATGAGCCTCGCAATCGCCGAGACGACCGTGACAGAGACAATCGGAGACGCATC
GCGTCGCCTCCGGCGAATATAGATCGTTATGTTCCTGGTCAAGATAGCTCTCCTGCAGCCTTGGCGGTCAACCCA
CTTGCTGATCCGGCTCGGCTCCCATACCAGGTCGGCTTCTCTTACTTTGGAGAGTGGTGGCGGTTGAACGAGAAG
GTCAAGGAAGACAAAGAGCGTGCTCGCACTGGTCGCAGGCGAGAACCCGAGAGGAATCGGAGCTCGCGCGAGATT
CAGGAAGAACGCGACAAGGAAAAGACCAAAATACAAGCTGCCTACGACGCCTACAAGGAAGAACTCCAAGCTAAG
ATGGCTCGAAACTTCGTTTCTGAGCATAAGAAAGAGCAGTGGTTCAGGGAGAGATACGTCCCCGAGGTCAGAAAC
GAGGTGAGAGCCAAGATTAATGAGATGCGGCGAGGAGCCTACACCCAGTGGGAGCAGGATCTTGAATCCGGCACC
TTCGACAGTTTCTCGCTTGAGGGCCTTCCTAAGAGCGAGAGCAACGGCGCCGGCGGCCTTGTCGAGAAGGAAGAG
GGCGAGACGACGGCGAGCAATGAAATCCTCGGCGTCGGCGATCTCATTCCCGCCAATGGTGCCGACATTCGCGAT
GAGAATCAGTTTCAGCCTACTCTGCTCATCAAGACCATTGCCCCGCACGTCAGCCGTCGGAACCTCGAGGCCTTC
TGCAAGGAGAACCTCGGCGAGGAAGAGGGTGGGTTCAAGTGGCTGTCGCTCTCCGACCCCAACCCCAGTAAACGC
TACCATCGCATCGGATGGGTCATGCTTCATCCTGCTTCTGAGGCGCCCATGCCCATTGGCCGGGCTGAGCCCAAG
GACGAGTACGCAGACGAGGCGTCCAAGTCTCCGCAGCTCGTGTCAACGGCAGAAAAGGCCCTTGAAGCGATCAAC
GGCAAGACGGTCAAGGACGAAGTGCGGGGGGACTTTGTCTGCCACGTCGGCGTTCACAACCCACCAATGAACCCG
AGGAAGAAAGCCTTGTGGGACTTATTTTCGGCCCCCGAACGCATTGAGAGGGATTTCCTGCTCGTCCAGAGACTC
GTAAATCGGTTTGAGACGGATTACGGCTCCGATTTCGCTGGTGTTCTCAAGGTGGAGGAAAAGGTTTACGACCTT
CGCAACGCTGGCTTGCTGCAGCCCGTGGCCCTCTCAACGGCTCCCAAGAAGGTGAAAAAAATGCGAGAGGTGGCC
ATGGACGAAGCCATGGACGATGAAGAAGACACGTTGATGGACGAAGAGGAAGATGATGGAGCTGCCGATGACGAT
GAGACTGACGATGAACATCTCTTGATCAAGAAAAAGCAACTAGATCTCCTGATCGAATACCTTCGTCGAGTCTTC
AACTTTTGCTTCTTTTGCGTCTTCGAGAGCGACTCCATCCACGAATTGACTCGCAAATGTCCCGGCGGACACCTC
CGTCGGCCTCGAAGCACGCTGTCCTCTTCGGCGAGGGCGGTCGCTCGCGCGAGTGCGACAGGCGAGCCGTTTCCC
GGGAAAAAGCGAAGCGATGCCGGCGAAGAAGAAACACATCGACTTTTACAGGTTCTGGAGCCGGATTCTGTCGAT
CTCCGCAAGTTGGGGGGCCGACCTGTGGGCGACGCCGTCGACGAGGAGCTCGCCAAGTTTGTCAAGCAGGAAGAC
GAACACAAGTGGCGCTGCAAGGTTCCCGACTGCACCAAGCTTTTCAAGGAAGAGCACTTTTGGAAGAAGCATGTC
GAGAAGCGACATGCCGAATGGCTTGATAGCATCAGGCAAGAATTTGAACTCATCAATGCCTACGTGACGGATCCT
GCCCACATTGCGCCTTCGCGGACCGACGCCAACTCCAACGGACACTTCCCGCCCTCCAGCGGGCAGACGACTACT
GGCACGCCCCGGGGCTTCAACCTGCAAAACTTTTCCATGAACGGCAACATGGGGATGCCGGGGTTCCCGATGCCT
CCTGGGGGCTTCCTCCCCATGTTCCCCAGCATGCCGACGACAGGTTGGAATCCGATGGGCGACGACCGTTCGGGC
GGCGCGATCCGGCGAGGTGGCATGGGTGGCGGGCGCGGACAATTCCGGACGGGACCGTACGACCGCCGCCGAGGC
CAGCACTGGGACGCTGGTGGTGGCGGGCGTGGTCGTATGGGCGGGTCTCGCTGGGGTGACGGAGCCGGCGGAGCG
ACTGGAGGGCCCCGTGAGGCGGTCCAAGGCAGAAGTCTGAAGAGCTACGAGGACCTCGACCAGGCGTCTAGCGGC
GGCGGCGGCGGCGAGCTCAACTAC
Transcript >Ophio5|1518
ATGCTCCTCAGTTCCGCATACGGAGGCAAGTGCTGGAAAGCTCGCGCGTCCAAGTACAGATTGCTCCAGCAGTAC
GCAAAGTTAAACACTGTATACGCGGGAAAGCTGCCTCCACTATGTAACTGCACTGCAGTGGGTGCAGACCGCAAG
GTAATGCCACGTTCGGTACATGTTCCTCATCTCACTCGTGCACCTCTCGTTGCACAGTCAGCAACGGCCGCTAAA
CTCACTTCCCAGTTTCACCCACGCGCCGCGGCTCCACCAAATCGCTGCCGTCGATTCGAGCCTCTCCCTCTTCCA
ACTCTTCCTCCCCAAACCTCCGCTCGTCCACGCATGATCTCGTTCAGCGGCGCGCCACAGCTCGCGCCGCTTTTC
TTTCGCTGCTCTGATAGCGACCTTCATTGCCACAGTACAGATCCCTGCCGTCAACGCAAAGAGAGCTCGATTTTT
GAGCGTTCAAACCTCACCATGTGGCGTGACGACTCGGCGAGATCGCCCTCGGAGCGAAACTGGGGTCGTGACGAT
CGCGATGACCGAACCGATAATTTTTATCGTTCCAGATCGCCAGGAAATGAACGGAGAGATCGCCGACGTTCCCGC
TCACCACCCGCCGTCGATCGGTATGAGCCTCGCAATCGCCGAGACGACCGTGACAGAGACAATCGGAGACGCATC
GCGTCGCCTCCGGCGAATATAGATCGTTATGTTCCTGGTCAAGATAGCTCTCCTGCAGCCTTGGCGGTCAACCCA
CTTGCTGATCCGGCTCGGCTCCCATACCAGGTCGGCTTCTCTTACTTTGGAGAGTGGTGGCGGTTGAACGAGAAG
GTCAAGGAAGACAAAGAGCGTGCTCGCACTGGTCGCAGGCGAGAACCCGAGAGGAATCGGAGCTCGCGCGAGATT
CAGGAAGAACGCGACAAGGAAAAGACCAAAATACAAGCTGCCTACGACGCCTACAAGGAAGAACTCCAAGCTAAG
ATGGCTCGAAACTTCGTTTCTGAGCATAAGAAAGAGCAGTGGTTCAGGGAGAGATACGTCCCCGAGGTCAGAAAC
GAGGTGAGAGCCAAGATTAATGAGATGCGGCGAGGAGCCTACACCCAGTGGGAGCAGGATCTTGAATCCGGCACC
TTCGACAGTTTCTCGCTTGAGGGCCTTCCTAAGAGCGAGAGCAACGGCGCCGGCGGCCTTGTCGAGAAGGAAGAG
GGCGAGACGACGGCGAGCAATGAAATCCTCGGCGTCGGCGATCTCATTCCCGCCAATGGTGCCGACATTCGCGAT
GAGAATCAGTTTCAGCCTACTCTGCTCATCAAGACCATTGCCCCGCACGTCAGCCGTCGGAACCTCGAGGCCTTC
TGCAAGGAGAACCTCGGCGAGGAAGAGGGTGGGTTCAAGTGGCTGTCGCTCTCCGACCCCAACCCCAGTAAACGC
TACCATCGCATCGGATGGGTCATGCTTCATCCTGCTTCTGAGGCGCCCATGCCCATTGGCCGGGCTGAGCCCAAG
GACGAGTACGCAGACGAGGCGTCCAAGTCTCCGCAGCTCGTGTCAACGGCAGAAAAGGCCCTTGAAGCGATCAAC
GGCAAGACGGTCAAGGACGAAGTGCGGGGGGACTTTGTCTGCCACGTCGGCGTTCACAACCCACCAATGAACCCG
AGGAAGAAAGCCTTGTGGGACTTATTTTCGGCCCCCGAACGCATTGAGAGGGATTTCCTGCTCGTCCAGAGACTC
GTAAATCGGTTTGAGACGGATTACGGCTCCGATTTCGCTGGTGTTCTCAAGGTGGAGGAAAAGGTTTACGACCTT
CGCAACGCTGGCTTGCTGCAGCCCGTGGCCCTCTCAACGGCTCCCAAGAAGGTGAAAAAAATGCGAGAGGTGGCC
ATGGACGAAGCCATGGACGATGAAGAAGACACGTTGATGGACGAAGAGGAAGATGATGGAGCTGCCGATGACGAT
GAGACTGACGATGAACATCTCTTGATCAAGAAAAAGCAACTAGATCTCCTGATCGAATACCTTCGTCGAGTCTTC
AACTTTTGCTTCTTTTGCGTCTTCGAGAGCGACTCCATCCACGAATTGACTCGCAAATGTCCCGGCGGACACCTC
CGTCGGCCTCGAAGCACGCTGTCCTCTTCGGCGAGGGCGGTCGCTCGCGCGAGTGCGACAGGCGAGCCGTTTCCC
GGGAAAAAGCGAAGCGATGCCGGCGAAGAAGAAACACATCGACTTTTACAGGTTCTGGAGCCGGATTCTGTCGAT
CTCCGCAAGTTGGGGGGCCGACCTGTGGGCGACGCCGTCGACGAGGAGCTCGCCAAGTTTGTCAAGCAGGAAGAC
GAACACAAGTGGCGCTGCAAGGTTCCCGACTGCACCAAGCTTTTCAAGGAAGAGCACTTTTGGAAGAAGCATGTC
GAGAAGCGACATGCCGAATGGCTTGATAGCATCAGGCAAGAATTTGAACTCATCAATGCCTACGTGACGGATCCT
GCCCACATTGCGCCTTCGCGGACCGACGCCAACTCCAACGGACACTTCCCGCCCTCCAGCGGGCAGACGACTACT
GGCACGCCCCGGGGCTTCAACCTGCAAAACTTTTCCATGAACGGCAACATGGGGATGCCGGGGTTCCCGATGCCT
CCTGGGGGCTTCCTCCCCATGTTCCCCAGCATGCCGACGACAGGTTGGAATCCGATGGGCGACGACCGTTCGGGC
GGCGCGATCCGGCGAGGTGGCATGGGTGGCGGGCGCGGACAATTCCGGACGGGACCGTACGACCGCCGCCGAGGC
CAGCACTGGGACGCTGGTGGTGGCGGGCGTGGTCGTATGGGCGGGTCTCGCTGGGGTGACGGAGCCGGCGGAGCG
ACTGGAGGGCCCCGTGAGGCGGTCCAAGGCAGAAGTCTGAAGAGCTACGAGGACCTCGACCAGGCGTCTAGCGGC
GGCGGCGGCGGCGAGCTCAACTACTGA
Gene >Ophio5|1518
ATGCTCCTCAGTTCCGCATACGGAGGTACAATAGTAAGCTTCAGCGTGCCCGGTGCAGCCTCTCCCTGCTGGAGC
CACAGGCAAGTGCTGGAAAGCTCGCGCGTCCAAGTACAGATTGCTCCAGCAGTACGCAAAGTTAAACACTGTATA
CGCGGGAAAGCTGCCTCCACTATGTAACTGCACTGCAGTGGGTGCAGACCGCAAGGTAATGCCACGTTCGGTACA
TGTTCCTCATCTCACTCGTGCACCTCTCGTTGCACAGTCAGCAACGGCCGCTAAACTCACTTCCCAGTTTCACCC
ACGCGCCGCGGCTCCACCAAATCGCTGCCGTCGATTCGAGCCTCTCCCTCTTCCAACTCTTCCTCCCCAAACCTC
CGCTCGTCCACGCATGATCTCGTTCAGCGGCGCGCCACAGCTCGCGCCGCTTTTCTTTCGCTGCTCTGATAGCGA
CCTTCATTGCCACAGTTCGTCCTGCGTTTCCTTCTTTTCCTCTTCTTCTATTCCTTCAACCCTCCCCGCTTCCTC
TTCTCCCCCCCCCTCGCCCTCGCCATGTTCTGCACTTTGTGCCCCGGCCTTCAGGCCATTTCTGTTTCTTCTCTT
CGTTCTTCCTCACTATCGCTTTCTACGCCTCTCAGGTCGTTTTGTTCATGACTCTCTCGGCCTAGCTGTCACCCC
TCCTATCCACAGCCCGGCTTTGCGTTTTCTTTTTCTCTGACGAACCTCTGTTCCTCTATCAATAGGTACAGATCC
CTGCCGTCAACGCAAAGAGAGCTCGGTTCTAGCCGATGCACACGCGATCCCTACTCACCAATTAGATTTTTGAGC
GTTCAAACCTCACCATGTGGCGTGACGACTCGGCGAGATCGCCCTCGGAGCGAAACTGGGGTCGTGACGATCGCG
ATGACCGAACCGATAATTTTTATCGTTCCAGATCGCCAGGTATACCCACCTAATCCTTTCCAGTGATTGAGCGAG
AAAACTAATTGCAACTGCATAGGAAATGAACGGAGAGATCGCCGACGTTCCCGCTCACCACCCGCCGTCGATCGG
TATGAGCCTCGCAATCGCCGAGACGACCGTGACAGAGACAATCGGAGACGCATCGCGTCGCCTCCGGCGAATATA
GATCGTTATGTTCCTGGTCAAGATAGCTCTCCTGCAGCCTTGGCGGTCAACCCACTTGCTGATCCGGCTCGGCTC
CCATACCAGGTCGGCTTCTCTTACTTTGGAGAGTGGTGGCGGTTGAACGAGAAGGTCAAGGAAGACAAAGAGCGT
GCTCGCACTGGTCGCAGGCGAGAACCCGAGAGGAATCGGAGCTCGCGCGAGATTCAGGAAGAACGCGACAAGGAA
AAGACCAAAATACAAGCTGCCTACGACGCCTACAAGGAAGAACTCCAAGCTAAGATGGCTCGAAACTTCGTTTCT
GAGCATAAGAAAGAGCAGTGGTTCAGGGAGAGATACGTCCCCGAGGTCAGAAACGAGGTGAGAGCCAAGATTAAT
GAGATGCGGCGAGGAGCCTACACCCAGTGGGAGCAGGATCTTGAATCCGGCACCTTCGACAGTTTCTCGCTTGAG
GGCCTTCCTAAGAGCGAGAGCAACGGCGCCGGCGGCCTTGTCGAGAAGGAAGAGGGCGAGACGACGGCGAGCAAT
GAAATCCTCGGCGTCGGCGATCTCATTCCCGCCAATGGTGCCGACATTCGCGATGAGAATCAGTTTCAGCCTACT
CTGCTCATCAAGACCATTGCCCCGCACGTCAGCCGTCGGAACCTCGAGGCCTTCTGCAAGGAGAACCTCGGCGAG
GAAGAGGGTGGGTTCAAGTGGCTGTCGCTCTCCGACCCCAACCCCAGTAAACGCTACCATCGCATCGGATGGGTC
ATGCTTCATCCTGCTTCTGAGGCGCCCATGCCCATTGGCCGGGCTGAGCCCAAGGACGAGTACGCAGACGAGGCG
TCCAAGTCTCCGCAGCTCGTGTCAACGGCAGAAAAGGCCCTTGAAGCGATCAACGGCAAGACGGTCAAGGACGAA
GTGCGGGGGGACTTTGTCTGCCACGTCGGCGTTCACAACCCACCAATGAACCCGAGGAAGAAAGCCTTGTGGGAC
TTATTTTCGGCCCCCGAACGCATTGAGAGGGATTTCCTGCTCGTCCAGAGACTCGTAAATCGGTTTGAGACGGAT
TACGGCTCCGATTTCGCTGGTGTTCTCAAGGTGGAGGAAAAGGTTTACGACCTTCGCAACGCTGGCTTGCTGCAG
CCCGTGGCCCTCTCAACGGCTCCCAAGAAGGTGAAAAAAATGCGAGAGGTGGCCATGGACGAAGCCATGGACGAT
GAAGAAGACACGTTGATGGACGAAGAGGAAGATGATGGAGCTGCCGATGACGATGAGACTGACGATGAACATCTC
TTGATCAAGAAAAAGCAACTAGATCTCCTGATCGAATACCTTCGTCGAGTCTTCAACTTTTGCTTCTTTTGCGTC
TTCGAGAGCGACTCCATCCACGAATTGACTCGCAAATGTCCCGGCGGACACCTCCGTCGGCCTCGAAGCACGCTG
TCCTCTTCGGCGAGGGCGGTCGCTCGCGCGAGTGCGACAGGCGAGCCGTTTCCCGGGAAAAAGCGAAGCGATGCC
GGCGAAGAAGGTGAAGTAGAATCACCAGAAGCTGAGAAGAGATTCAGAAACACATCGAGTAAGACAGAGCAGCAA
CTTCTTCGCGCGTACAACTGGGTCAAGACGTTTGAGGACAAGCTTTTACAGGTTCTGGAGCCGGATTCTGTCGAT
CTCCGCAAGTTGGGGGGCCGACCTGTGGGCGACGCCGTCGACGAGGAGCTCGCCAAGTTTGTCAAGCAGGAAGAC
GAACACAAGTGGCGCTGCAAGGTTCCCGACTGCACCAAGCTTTTCAAGGAAGAGCACTTTTGGAAGAAGCATGTC
GAGAAGCGACATGCCGAATGGCTTGATAGCATCAGGCAAGAAGTGAGTGCTCACTGCGTCGAGACGTTCCCCCTT
TTGATTCGCAAGCTCATGATAGTGTCCAGTTTGAACTCATCAATGCCTACGTGACGGATCCTGCCCACATTGCGC
CTTCGCGGACCGACGCCAACTCCAACGGACACTTCCCGCCCTCCAGCGGGCAGACGACTACTGGCACGCCCCGGG
GCTTCAACCTGCAAAACTTTTCCATGAACGGCAACATGGGGATGCCGGGGTTCCCGATGCCTCCTGGGGGCTTCC
TCCCCATGTTCCCCAGCATGCCGACGACAGGTTGGAATCCGATGGGCGACGACCGTTCGGGCGGCGCGATCCGGC
GAGGTGGCATGGGTGGCGGGCGCGGACAATTCCGGACGGGACCGTACGACCGCCGCCGAGGCCAGCACTGGGACG
CTGGTGGTGGCGGGCGTGGTCGTATGGGCGGGTCTCGCTGGGGTGACGGAGCCGGCGGAGCGACTGGAGGGCCCC
GTGAGGCGGTCCAAGGCAGAAGTCTGAAGAGCTACGAGGACCTCGACCAGGCGTCTAGCGGCGGCGGCGGCGGCG
AGCTCAACTACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail