Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1511
Gene name
Locationscaffold_1530:7..944
Strand+
Gene length (bp)937
Transcript length (bp)873
Coding sequence length (bp)870
Protein length (aa) 290

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 2.2E-18 1 131

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 1 215 2.0E-37
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 1 154 2.0E-28
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 2 229 1.0E-17
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 2 132 2.0E-17
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 2 132 1.0E-16
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 1 215 2.0E-37
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 1 154 2.0E-28
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 2 229 1.0E-17
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 2 132 2.0E-17
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 2 132 1.0E-16
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 2 132 1.0E-16
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 2 132 1.0E-16
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 2 132 1.0E-16
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 2 180 2.0E-16
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 2 159 2.0E-16
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 2 135 3.0E-16
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 2 139 3.0E-16
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 2 139 3.0E-16
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 2 180 8.0E-16
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 2 227 1.0E-15
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 2 132 2.0E-15
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 2 132 2.0E-15
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 2 149 4.0E-15
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 2 149 4.0E-15
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 2 149 4.0E-15
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 2 132 9.0E-15
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 2 132 1.0E-14
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 2 134 3.0E-14
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 2 135 1.0E-12
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 2 132 2.0E-12
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 2 132 6.0E-12
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 39 135 9.0E-12
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 2 132 1.0E-11
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 5 132 1.0E-10
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 2 132 1.0E-10
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 2 132 5.0E-10
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 2 134 9.0E-10
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 2 132 2.0E-09
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 2 80 1.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 7 24 17
2 39 56 17
3 77 99 22
4 109 131 22
5 247 269 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1511
MILGQAAYQLVITFILYYGIPKHWFDSFTAKDQLLPEEINTMVFNTFVWMQIFNQWNNRRLDNRFNIFEGLTKNW
IFVAISILMCGGQILIIFVGGAAFQIAKQGQDGSQWIMAVVLGFLSIPMGVVLRLIPDEAIAAMMPGFLKNRARR
VPGLTVSDEEMGQYPEPLAELRDELKFIRRMKGGRLNNLKFKIQQRTETVLRQRSRSPSHSRSDSTKAPRTPTLE
ESGELRAPTLERQRTRSTRSRSNSALGAPTVMAGIVAAGVAAGWSATGRVNAEERSADEDSTGER
Coding >Ophio5|1511
ATGATACTGGGCCAGGCAGCGTACCAACTCGTCATCACGTTTATCCTGTACTATGGGATCCCGAAGCACTGGTTC
GACAGTTTCACGGCTAAAGACCAGCTGCTTCCGGAGGAGATCAACACGATGGTGTTTAACACGTTTGTGTGGATG
CAGATTTTCAATCAGTGGAACAACCGGCGACTGGACAACCGGTTCAACATTTTCGAGGGTCTCACGAAGAACTGG
ATCTTCGTCGCCATCAGCATCCTCATGTGTGGCGGGCAGATTCTGATCATCTTCGTCGGGGGCGCGGCCTTTCAA
ATCGCCAAGCAGGGGCAGGACGGCTCGCAGTGGATCATGGCGGTGGTGCTCGGCTTCCTCTCGATACCGATGGGG
GTGGTGCTGCGTCTGATTCCGGACGAGGCGATTGCGGCGATGATGCCGGGCTTCCTCAAGAACAGGGCGCGGCGG
GTGCCGGGGCTGACGGTGTCGGACGAGGAGATGGGCCAGTACCCGGAGCCGCTGGCGGAGCTGCGAGACGAGCTC
AAGTTTATCCGGCGGATGAAGGGCGGGCGGCTGAACAATCTGAAGTTTAAGATTCAGCAGCGGACGGAGACGGTG
CTGAGGCAGCGATCGAGGAGCCCATCGCACTCGCGGTCGGACTCGACCAAGGCGCCGCGGACGCCGACGCTGGAG
GAAAGCGGCGAGTTGCGGGCGCCGACGCTGGAGAGGCAGCGAACGAGATCGACGCGGTCGCGGTCCAACTCGGCG
CTGGGGGCGCCTACGGTCATGGCGGGCATCGTGGCGGCCGGCGTGGCGGCCGGATGGTCAGCAACGGGACGGGTG
AATGCCGAGGAGAGGAGCGCAGACGAGGATAGCACGGGGGAGAGG
Transcript >Ophio5|1511
ATGATACTGGGCCAGGCAGCGTACCAACTCGTCATCACGTTTATCCTGTACTATGGGATCCCGAAGCACTGGTTC
GACAGTTTCACGGCTAAAGACCAGCTGCTTCCGGAGGAGATCAACACGATGGTGTTTAACACGTTTGTGTGGATG
CAGATTTTCAATCAGTGGAACAACCGGCGACTGGACAACCGGTTCAACATTTTCGAGGGTCTCACGAAGAACTGG
ATCTTCGTCGCCATCAGCATCCTCATGTGTGGCGGGCAGATTCTGATCATCTTCGTCGGGGGCGCGGCCTTTCAA
ATCGCCAAGCAGGGGCAGGACGGCTCGCAGTGGATCATGGCGGTGGTGCTCGGCTTCCTCTCGATACCGATGGGG
GTGGTGCTGCGTCTGATTCCGGACGAGGCGATTGCGGCGATGATGCCGGGCTTCCTCAAGAACAGGGCGCGGCGG
GTGCCGGGGCTGACGGTGTCGGACGAGGAGATGGGCCAGTACCCGGAGCCGCTGGCGGAGCTGCGAGACGAGCTC
AAGTTTATCCGGCGGATGAAGGGCGGGCGGCTGAACAATCTGAAGTTTAAGATTCAGCAGCGGACGGAGACGGTG
CTGAGGCAGCGATCGAGGAGCCCATCGCACTCGCGGTCGGACTCGACCAAGGCGCCGCGGACGCCGACGCTGGAG
GAAAGCGGCGAGTTGCGGGCGCCGACGCTGGAGAGGCAGCGAACGAGATCGACGCGGTCGCGGTCCAACTCGGCG
CTGGGGGCGCCTACGGTCATGGCGGGCATCGTGGCGGCCGGCGTGGCGGCCGGATGGTCAGCAACGGGACGGGTG
AATGCCGAGGAGAGGAGCGCAGACGAGGATAGCACGGGGGAGAGGTAG
Gene >Ophio5|1511
ATGATACTGGGCCAGGCAGCGTACCAACTCGTCATCACGTTTATCCTGTACTATGGGATCCCGAAGCACTGGTTC
GACAGTTTCACGGCTAAAGACCAGCTGCTTCCGGAGGAGATCAACACGATGGTGTTTAACACGTTTGTGTGGATG
CAGATTTTCAATCAGTGGAAGTGAGTGGCGACGAAAAGGAGGTGGCGGCAGATGTAGGGAGATTTGCTGACGTGT
GGATTGCAGCAACCGGCGACTGGACAACCGGTTCAACATTTTCGAGGGTCTCACGAAGAACTGGATCTTCGTCGC
CATCAGCATCCTCATGTGTGGCGGGCAGATTCTGATCATCTTCGTCGGGGGCGCGGCCTTTCAAATCGCCAAGCA
GGGGCAGGACGGCTCGCAGTGGATCATGGCGGTGGTGCTCGGCTTCCTCTCGATACCGATGGGGGTGGTGCTGCG
TCTGATTCCGGACGAGGCGATTGCGGCGATGATGCCGGGCTTCCTCAAGAACAGGGCGCGGCGGGTGCCGGGGCT
GACGGTGTCGGACGAGGAGATGGGCCAGTACCCGGAGCCGCTGGCGGAGCTGCGAGACGAGCTCAAGTTTATCCG
GCGGATGAAGGGCGGGCGGCTGAACAATCTGAAGTTTAAGATTCAGCAGCGGACGGAGACGGTGCTGAGGCAGCG
ATCGAGGAGCCCATCGCACTCGCGGTCGGACTCGACCAAGGCGCCGCGGACGCCGACGCTGGAGGAAAGCGGCGA
GTTGCGGGCGCCGACGCTGGAGAGGCAGCGAACGAGATCGACGCGGTCGCGGTCCAACTCGGCGCTGGGGGCGCC
TACGGTCATGGCGGGCATCGTGGCGGCCGGCGTGGCGGCCGGATGGTCAGCAACGGGACGGGTGAATGCCGAGGA
GAGGAGCGCAGACGAGGATAGCACGGGGGAGAGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail