Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|151
Gene name
Locationscaffold_1010:482..2304
Strand+
Gene length (bp)1822
Transcript length (bp)1671
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 174 464 8.0E-13
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 69 447 1.0E-11
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 136 470 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 534 553 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 38.28 20.75 55.82
CcL In ants, during behavior modification 27.35 13.86 40.85
CcD In ants, recently dead 34.33 18.38 50.29

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.170958 no
SC16a CcD 0.673903 no
CcL CcD 0.369394 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|151
MATCDARVSTPLSGGEDLLTSSSSSSSSSSSSAAATVDLLVLTFNCAKQLISPGVFGRHLRWAMGRNAGGLPEVV
VLSLQEVAPLSKAFVGEYFLDGYLERFGEAVNGAAVRKKKKKEKKKKGGEATTTTTGSTTETTDTPPYTLVKARN
VGYTAMMLFARHPARLSAVLEAEMGFGAADMGNKGAVGMRTLYSDPDGKTTELTFVATHLAAMEWNLPRRNANWA
AIMRGLTFANPEQVFARDDEGNVDGDEMDEDEADDAPLLPRGDHQGEDEGDGQQHARLRRRLHDLSVYKPSSHLF
VAGDLNYRIATTPPPPGAALPSLDRRSHHHFGAFLPLDQLTRERRAGRTLHGLVEAPVEFPPTYKYVPLGDKAHD
NEDDDGGFCDERQHYEDEDGDEDEDKDVVRWRFASHRWPAWTDRILYLDVPPWVRAQNGPRIRVRAYDALPVVRT
SDHRAVFLRVDVPLVGPRELAPPSSLSSDVTSPPSWAHDATATDPRLRLPVEIDPEAWARRRAARQKEKLVGWTM
LLWSSSEGAWVLLASLVVAAGGAYWFYYSGV
Coding >Ophio5|151
ATGGCGACGTGCGACGCTCGAGTTTCCACTCCCCTGTCAGGCGGCGAGGACCTGCTGACGTCGTCGTCGTCGTCG
TCGTCGTCGTCGTCGTCGTCGGCGGCGGCGACGGTCGACCTGCTGGTTCTCACCTTCAACTGCGCGAAGCAGCTC
ATCAGCCCGGGGGTGTTTGGTCGGCATCTTCGGTGGGCGATGGGAAGGAATGCGGGGGGGTTGCCGGAGGTGGTT
GTGCTGTCTTTGCAGGAGGTGGCGCCGCTTAGCAAGGCGTTTGTGGGTGAGTATTTCTTGGATGGGTATTTGGAG
AGGTTTGGGGAGGCAGTTAATGGTGCGGCGGTGAGGAAAAAGAAAAAGAAGGAGAAGAAGAAGAAGGGGGGGGAG
GCGACGACAACGACGACGGGAAGCACGACAGAAACCACCGACACCCCCCCATATACGCTCGTCAAAGCCCGCAAC
GTCGGCTACACAGCCATGATGCTCTTTGCGCGGCACCCGGCGCGGCTGAGCGCCGTGCTCGAGGCCGAGATGGGC
TTTGGCGCGGCGGATATGGGCAACAAGGGCGCCGTCGGCATGCGAACCCTCTACTCAGACCCTGACGGCAAGACG
ACGGAGCTGACGTTTGTGGCGACGCACCTGGCGGCCATGGAGTGGAACCTGCCGCGGCGGAATGCGAATTGGGCA
GCTATTATGCGTGGACTGACGTTTGCGAATCCGGAGCAGGTTTTTGCCCGAGATGATGAGGGCAACGTTGATGGT
GATGAGATGGACGAGGACGAGGCCGACGATGCCCCTCTGCTACCGCGCGGTGACCACCAAGGAGAAGACGAGGGC
GACGGCCAGCAGCACGCACGTCTGCGCCGACGGCTTCACGACCTCTCAGTCTACAAGCCCTCGTCGCACCTCTTC
GTCGCCGGCGACCTCAACTACCGTATCGCCACGACGCCGCCTCCGCCCGGCGCGGCGCTGCCGAGCCTCGACCGG
CGATCGCATCATCACTTCGGAGCCTTCTTGCCGTTGGATCAGCTGACGCGCGAGAGGCGGGCCGGCAGGACGCTG
CACGGGTTGGTGGAAGCGCCGGTGGAATTTCCGCCGACATACAAGTATGTGCCTCTGGGGGACAAGGCACATGAT
AACGAGGACGACGATGGTGGCTTTTGCGACGAGAGGCAGCATTACGAGGACGAGGACGGGGACGAGGATGAAGAC
AAGGACGTGGTTCGTTGGCGTTTCGCCTCTCATCGCTGGCCGGCCTGGACGGATCGAATTCTCTACCTCGACGTG
CCGCCGTGGGTACGGGCGCAGAACGGTCCGCGGATCCGAGTGCGCGCATACGACGCCCTGCCCGTGGTGCGGACG
AGCGATCACCGGGCCGTCTTCCTACGCGTCGACGTGCCCCTCGTCGGACCGAGGGAACTCGCGCCTCCGTCCTCA
CTCTCGTCTGACGTGACGTCGCCGCCATCTTGGGCGCACGATGCCACGGCCACGGACCCTCGTCTCCGGCTCCCC
GTCGAGATCGACCCGGAGGCCTGGGCGCGACGAAGGGCGGCGCGGCAGAAGGAGAAGCTGGTCGGTTGGACGATG
CTCCTCTGGAGTTCGAGCGAGGGGGCTTGGGTGCTACTCGCCTCGTTGGTAGTTGCCGCGGGAGGGGCGTATTGG
TTTTACTATTCCGGGGTT
Transcript >Ophio5|151
ATGGCGACGTGCGACGCTCGAGTTTCCACTCCCCTGTCAGGCGGCGAGGACCTGCTGACGTCGTCGTCGTCGTCG
TCGTCGTCGTCGTCGTCGTCGGCGGCGGCGACGGTCGACCTGCTGGTTCTCACCTTCAACTGCGCGAAGCAGCTC
ATCAGCCCGGGGGTGTTTGGTCGGCATCTTCGGTGGGCGATGGGAAGGAATGCGGGGGGGTTGCCGGAGGTGGTT
GTGCTGTCTTTGCAGGAGGTGGCGCCGCTTAGCAAGGCGTTTGTGGGTGAGTATTTCTTGGATGGGTATTTGGAG
AGGTTTGGGGAGGCAGTTAATGGTGCGGCGGTGAGGAAAAAGAAAAAGAAGGAGAAGAAGAAGAAGGGGGGGGAG
GCGACGACAACGACGACGGGAAGCACGACAGAAACCACCGACACCCCCCCATATACGCTCGTCAAAGCCCGCAAC
GTCGGCTACACAGCCATGATGCTCTTTGCGCGGCACCCGGCGCGGCTGAGCGCCGTGCTCGAGGCCGAGATGGGC
TTTGGCGCGGCGGATATGGGCAACAAGGGCGCCGTCGGCATGCGAACCCTCTACTCAGACCCTGACGGCAAGACG
ACGGAGCTGACGTTTGTGGCGACGCACCTGGCGGCCATGGAGTGGAACCTGCCGCGGCGGAATGCGAATTGGGCA
GCTATTATGCGTGGACTGACGTTTGCGAATCCGGAGCAGGTTTTTGCCCGAGATGATGAGGGCAACGTTGATGGT
GATGAGATGGACGAGGACGAGGCCGACGATGCCCCTCTGCTACCGCGCGGTGACCACCAAGGAGAAGACGAGGGC
GACGGCCAGCAGCACGCACGTCTGCGCCGACGGCTTCACGACCTCTCAGTCTACAAGCCCTCGTCGCACCTCTTC
GTCGCCGGCGACCTCAACTACCGTATCGCCACGACGCCGCCTCCGCCCGGCGCGGCGCTGCCGAGCCTCGACCGG
CGATCGCATCATCACTTCGGAGCCTTCTTGCCGTTGGATCAGCTGACGCGCGAGAGGCGGGCCGGCAGGACGCTG
CACGGGTTGGTGGAAGCGCCGGTGGAATTTCCGCCGACATACAAGTATGTGCCTCTGGGGGACAAGGCACATGAT
AACGAGGACGACGATGGTGGCTTTTGCGACGAGAGGCAGCATTACGAGGACGAGGACGGGGACGAGGATGAAGAC
AAGGACGTGGTTCGTTGGCGTTTCGCCTCTCATCGCTGGCCGGCCTGGACGGATCGAATTCTCTACCTCGACGTG
CCGCCGTGGGTACGGGCGCAGAACGGTCCGCGGATCCGAGTGCGCGCATACGACGCCCTGCCCGTGGTGCGGACG
AGCGATCACCGGGCCGTCTTCCTACGCGTCGACGTGCCCCTCGTCGGACCGAGGGAACTCGCGCCTCCGTCCTCA
CTCTCGTCTGACGTGACGTCGCCGCCATCTTGGGCGCACGATGCCACGGCCACGGACCCTCGTCTCCGGCTCCCC
GTCGAGATCGACCCGGAGGCCTGGGCGCGACGAAGGGCGGCGCGGCAGAAGGAGAAGCTGGTCGGTTGGACGATG
CTCCTCTGGAGTTCGAGCGAGGGGGCTTGGGTGCTACTCGCCTCGTTGGTAGTTGCCGCGGGAGGGGCGTATTGG
TTTTACTATTCCGGGGTTTGA
Gene >Ophio5|151
ATGGCGACGTGCGACGCTCGAGTTTCCACTCCCCTGTCAGGCGGCGAGGACCTGCTGACGTCGTCGTCGTCGTCG
TCGTCGTCGTCGTCGTCGTCGGCGGCGGCGACGGTCGACCTGCTGGTTCTCACCTTCAACTGCGCGAAGCAGCTC
ATCAGCCCGGGGGTGTTTGGTCGGCATCTTCGGTGGGCGATGGGAAGGAATGCGGGGGGGTTGCCGGAGGTGGTT
GTGCTGTGAGAAAACCCATTTCCCCCCCTCCACCCTCCTCGAAATACAAAGTGGTGAGAAGTGAAAAAAAAATAA
AAATAAAAAAAATAAGATAAGGGAGATTTCTTATTTACTTTGATTGGTTGGTTGCTGATGAGTCGAGCGTGAGTG
AAATAGGTCTTTGCAGGAGGTGGCGCCGCTTAGCAAGGCGTTTGTGGGTGAGTATTTCTTGGATGGGTATTTGGA
GAGGTTTGGGGAGGCAGTTAATGGTGCGGCGGTGAGGAAAAAGAAAAAGAAGGAGAAGAAGAAGAAGGGGGGGGA
GGCGACGACAACGACGACGGGAAGCACGACAGAAACCACCGACACCCCCCCATATACGCTCGTCAAAGCCCGCAA
CGTCGGCTACACAGCCATGATGCTCTTTGCGCGGCACCCGGCGCGGCTGAGCGCCGTGCTCGAGGCCGAGATGGG
CTTTGGCGCGGCGGATATGGGCAACAAGGGCGCCGTCGGCATGCGAACCCTCTACTCAGACCCTGACGGCAAGAC
GACGGAGCTGACGTTTGTGGCGACGCACCTGGCGGCCATGGAGTGGAACCTGCCGCGGCGGAATGCGAATTGGGC
AGCTATTATGCGTGGACTGACGTTTGCGAATCCGGAGCAGGTTTTTGCCCGAGATGATGAGGGCAACGTTGATGG
TGATGAGATGGACGAGGACGAGGCCGACGATGCCCCTCTGCTACCGCGCGGTGACCACCAAGGAGAAGACGAGGG
CGACGGCCAGCAGCACGCACGTCTGCGCCGACGGCTTCACGACCTCTCAGTCTACAAGCCCTCGTCGCACCTCTT
CGTCGCCGGCGACCTCAACTACCGTATCGCCACGACGCCGCCTCCGCCCGGCGCGGCGCTGCCGAGCCTCGACCG
GCGATCGCATCATCACTTCGGAGCCTTCTTGCCGTTGGATCAGCTGACGCGCGAGAGGCGGGCCGGCAGGACGCT
GCACGGGTTGGTGGAAGCGCCGGTGGAATTTCCGCCGACATACAAGTATGTGCCTCTGGGGGACAAGGCACATGA
TAACGAGGACGACGATGGTGGCTTTTGCGACGAGAGGCAGCATTACGAGGACGAGGACGGGGACGAGGATGAAGA
CAAGGACGTGGTTCGTTGGCGTTTCGCCTCTCATCGCTGGCCGGCCTGGACGGATCGAATTCTCTACCTCGACGT
GCCGCCGTGGGTACGGGCGCAGAACGGTCCGCGGATCCGAGTGCGCGCATACGACGCCCTGCCCGTGGTGCGGAC
GAGCGATCACCGGGCCGTCTTCCTACGCGTCGACGTGCCCCTCGTCGGACCGAGGGAACTCGCGCCTCCGTCCTC
ACTCTCGTCTGACGTGACGTCGCCGCCATCTTGGGCGCACGATGCCACGGCCACGGACCCTCGTCTCCGGCTCCC
CGTCGAGATCGACCCGGAGGCCTGGGCGCGACGAAGGGCGGCGCGGCAGAAGGAGAAGCTGGTCGGTTGGACGAT
GCTCCTCTGGAGTTCGAGCGAGGGGGCTTGGGTGCTACTCGCCTCGTTGGTAGTTGCCGCGGGAGGGGCGTATTG
GTTTTACTATTCCGGGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail