Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|151
Gene name
Locationscaffold_1010:482..2304
Strand+
Gene length (bp)1822
Transcript length (bp)1671
Coding sequence length (bp)1668
Protein length (aa) 556

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q84W55|IP5PF_ARATH Type II inositol polyphosphate 5-phosphatase 15 OS=Arabidopsis thaliana GN=IP5P15 PE=1 SV=2 174 464 8.0E-13
sp|O14306|YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC9G1.10c PE=1 SV=2 69 447 1.0E-11
sp|Q9FUR2|IP5P2_ARATH Type I inositol polyphosphate 5-phosphatase 2 OS=Arabidopsis thaliana GN=IP5P2 PE=1 SV=2 136 470 6.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 58 0.45

Transmembrane Domains

Domain # Start End Length
1 534 553 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|151
MATCDARVSTPLSGGEDLLTSSSSSSSSSSSSAAATVDLLVLTFNCAKQLISPGVFGRHLRWAMGRNAGGLPEVV
VLSLQEVAPLSKAFVGEYFLDGYLERFGEAVNGAAVRKKKKKEKKKKGGEATTTTTGSTTETTDTPPYTLVKARN
VGYTAMMLFARHPARLSAVLEAEMGFGAADMGNKGAVGMRTLYSDPDGKTTELTFVATHLAAMEWNLPRRNANWA
AIMRGLTFANPEQVFARDDEGNVDGDEMDEDEADDAPLLPRGDHQGEDEGDGQQHARLRRRLHDLSVYKPSSHLF
VAGDLNYRIATTPPPPGAALPSLDRRSHHHFGAFLPLDQLTRERRAGRTLHGLVEAPVEFPPTYKYVPLGDKAHD
NEDDDGGFCDERQHYEDEDGDEDEDKDVVRWRFASHRWPAWTDRILYLDVPPWVRAQNGPRIRVRAYDALPVVRT
SDHRAVFLRVDVPLVGPRELAPPSSLSSDVTSPPSWAHDATATDPRLRLPVEIDPEAWARRRAARQKEKLVGWTM
LLWSSSEGAWVLLASLVVAAGGAYWFYYSGV
Coding >Ophio5|151
ATGGCGACGTGCGACGCTCGAGTTTCCACTCCCCTGTCAGGCGGCGAGGACCTGCTGACGTCGTCGTCGTCGTCG
TCGTCGTCGTCGTCGTCGTCGGCGGCGGCGACGGTCGACCTGCTGGTTCTCACCTTCAACTGCGCGAAGCAGCTC
ATCAGCCCGGGGGTGTTTGGTCGGCATCTTCGGTGGGCGATGGGAAGGAATGCGGGGGGGTTGCCGGAGGTGGTT
GTGCTGTCTTTGCAGGAGGTGGCGCCGCTTAGCAAGGCGTTTGTGGGTGAGTATTTCTTGGATGGGTATTTGGAG
AGGTTTGGGGAGGCAGTTAATGGTGCGGCGGTGAGGAAAAAGAAAAAGAAGGAGAAGAAGAAGAAGGGGGGGGAG
GCGACGACAACGACGACGGGAAGCACGACAGAAACCACCGACACCCCCCCATATACGCTCGTCAAAGCCCGCAAC
GTCGGCTACACAGCCATGATGCTCTTTGCGCGGCACCCGGCGCGGCTGAGCGCCGTGCTCGAGGCCGAGATGGGC
TTTGGCGCGGCGGATATGGGCAACAAGGGCGCCGTCGGCATGCGAACCCTCTACTCAGACCCTGACGGCAAGACG
ACGGAGCTGACGTTTGTGGCGACGCACCTGGCGGCCATGGAGTGGAACCTGCCGCGGCGGAATGCGAATTGGGCA
GCTATTATGCGTGGACTGACGTTTGCGAATCCGGAGCAGGTTTTTGCCCGAGATGATGAGGGCAACGTTGATGGT
GATGAGATGGACGAGGACGAGGCCGACGATGCCCCTCTGCTACCGCGCGGTGACCACCAAGGAGAAGACGAGGGC
GACGGCCAGCAGCACGCACGTCTGCGCCGACGGCTTCACGACCTCTCAGTCTACAAGCCCTCGTCGCACCTCTTC
GTCGCCGGCGACCTCAACTACCGTATCGCCACGACGCCGCCTCCGCCCGGCGCGGCGCTGCCGAGCCTCGACCGG
CGATCGCATCATCACTTCGGAGCCTTCTTGCCGTTGGATCAGCTGACGCGCGAGAGGCGGGCCGGCAGGACGCTG
CACGGGTTGGTGGAAGCGCCGGTGGAATTTCCGCCGACATACAAGTATGTGCCTCTGGGGGACAAGGCACATGAT
AACGAGGACGACGATGGTGGCTTTTGCGACGAGAGGCAGCATTACGAGGACGAGGACGGGGACGAGGATGAAGAC
AAGGACGTGGTTCGTTGGCGTTTCGCCTCTCATCGCTGGCCGGCCTGGACGGATCGAATTCTCTACCTCGACGTG
CCGCCGTGGGTACGGGCGCAGAACGGTCCGCGGATCCGAGTGCGCGCATACGACGCCCTGCCCGTGGTGCGGACG
AGCGATCACCGGGCCGTCTTCCTACGCGTCGACGTGCCCCTCGTCGGACCGAGGGAACTCGCGCCTCCGTCCTCA
CTCTCGTCTGACGTGACGTCGCCGCCATCTTGGGCGCACGATGCCACGGCCACGGACCCTCGTCTCCGGCTCCCC
GTCGAGATCGACCCGGAGGCCTGGGCGCGACGAAGGGCGGCGCGGCAGAAGGAGAAGCTGGTCGGTTGGACGATG
CTCCTCTGGAGTTCGAGCGAGGGGGCTTGGGTGCTACTCGCCTCGTTGGTAGTTGCCGCGGGAGGGGCGTATTGG
TTTTACTATTCCGGGGTT
Transcript >Ophio5|151
ATGGCGACGTGCGACGCTCGAGTTTCCACTCCCCTGTCAGGCGGCGAGGACCTGCTGACGTCGTCGTCGTCGTCG
TCGTCGTCGTCGTCGTCGTCGGCGGCGGCGACGGTCGACCTGCTGGTTCTCACCTTCAACTGCGCGAAGCAGCTC
ATCAGCCCGGGGGTGTTTGGTCGGCATCTTCGGTGGGCGATGGGAAGGAATGCGGGGGGGTTGCCGGAGGTGGTT
GTGCTGTCTTTGCAGGAGGTGGCGCCGCTTAGCAAGGCGTTTGTGGGTGAGTATTTCTTGGATGGGTATTTGGAG
AGGTTTGGGGAGGCAGTTAATGGTGCGGCGGTGAGGAAAAAGAAAAAGAAGGAGAAGAAGAAGAAGGGGGGGGAG
GCGACGACAACGACGACGGGAAGCACGACAGAAACCACCGACACCCCCCCATATACGCTCGTCAAAGCCCGCAAC
GTCGGCTACACAGCCATGATGCTCTTTGCGCGGCACCCGGCGCGGCTGAGCGCCGTGCTCGAGGCCGAGATGGGC
TTTGGCGCGGCGGATATGGGCAACAAGGGCGCCGTCGGCATGCGAACCCTCTACTCAGACCCTGACGGCAAGACG
ACGGAGCTGACGTTTGTGGCGACGCACCTGGCGGCCATGGAGTGGAACCTGCCGCGGCGGAATGCGAATTGGGCA
GCTATTATGCGTGGACTGACGTTTGCGAATCCGGAGCAGGTTTTTGCCCGAGATGATGAGGGCAACGTTGATGGT
GATGAGATGGACGAGGACGAGGCCGACGATGCCCCTCTGCTACCGCGCGGTGACCACCAAGGAGAAGACGAGGGC
GACGGCCAGCAGCACGCACGTCTGCGCCGACGGCTTCACGACCTCTCAGTCTACAAGCCCTCGTCGCACCTCTTC
GTCGCCGGCGACCTCAACTACCGTATCGCCACGACGCCGCCTCCGCCCGGCGCGGCGCTGCCGAGCCTCGACCGG
CGATCGCATCATCACTTCGGAGCCTTCTTGCCGTTGGATCAGCTGACGCGCGAGAGGCGGGCCGGCAGGACGCTG
CACGGGTTGGTGGAAGCGCCGGTGGAATTTCCGCCGACATACAAGTATGTGCCTCTGGGGGACAAGGCACATGAT
AACGAGGACGACGATGGTGGCTTTTGCGACGAGAGGCAGCATTACGAGGACGAGGACGGGGACGAGGATGAAGAC
AAGGACGTGGTTCGTTGGCGTTTCGCCTCTCATCGCTGGCCGGCCTGGACGGATCGAATTCTCTACCTCGACGTG
CCGCCGTGGGTACGGGCGCAGAACGGTCCGCGGATCCGAGTGCGCGCATACGACGCCCTGCCCGTGGTGCGGACG
AGCGATCACCGGGCCGTCTTCCTACGCGTCGACGTGCCCCTCGTCGGACCGAGGGAACTCGCGCCTCCGTCCTCA
CTCTCGTCTGACGTGACGTCGCCGCCATCTTGGGCGCACGATGCCACGGCCACGGACCCTCGTCTCCGGCTCCCC
GTCGAGATCGACCCGGAGGCCTGGGCGCGACGAAGGGCGGCGCGGCAGAAGGAGAAGCTGGTCGGTTGGACGATG
CTCCTCTGGAGTTCGAGCGAGGGGGCTTGGGTGCTACTCGCCTCGTTGGTAGTTGCCGCGGGAGGGGCGTATTGG
TTTTACTATTCCGGGGTTTGA
Gene >Ophio5|151
ATGGCGACGTGCGACGCTCGAGTTTCCACTCCCCTGTCAGGCGGCGAGGACCTGCTGACGTCGTCGTCGTCGTCG
TCGTCGTCGTCGTCGTCGTCGGCGGCGGCGACGGTCGACCTGCTGGTTCTCACCTTCAACTGCGCGAAGCAGCTC
ATCAGCCCGGGGGTGTTTGGTCGGCATCTTCGGTGGGCGATGGGAAGGAATGCGGGGGGGTTGCCGGAGGTGGTT
GTGCTGTGAGAAAACCCATTTCCCCCCCTCCACCCTCCTCGAAATACAAAGTGGTGAGAAGTGAAAAAAAAATAA
AAATAAAAAAAATAAGATAAGGGAGATTTCTTATTTACTTTGATTGGTTGGTTGCTGATGAGTCGAGCGTGAGTG
AAATAGGTCTTTGCAGGAGGTGGCGCCGCTTAGCAAGGCGTTTGTGGGTGAGTATTTCTTGGATGGGTATTTGGA
GAGGTTTGGGGAGGCAGTTAATGGTGCGGCGGTGAGGAAAAAGAAAAAGAAGGAGAAGAAGAAGAAGGGGGGGGA
GGCGACGACAACGACGACGGGAAGCACGACAGAAACCACCGACACCCCCCCATATACGCTCGTCAAAGCCCGCAA
CGTCGGCTACACAGCCATGATGCTCTTTGCGCGGCACCCGGCGCGGCTGAGCGCCGTGCTCGAGGCCGAGATGGG
CTTTGGCGCGGCGGATATGGGCAACAAGGGCGCCGTCGGCATGCGAACCCTCTACTCAGACCCTGACGGCAAGAC
GACGGAGCTGACGTTTGTGGCGACGCACCTGGCGGCCATGGAGTGGAACCTGCCGCGGCGGAATGCGAATTGGGC
AGCTATTATGCGTGGACTGACGTTTGCGAATCCGGAGCAGGTTTTTGCCCGAGATGATGAGGGCAACGTTGATGG
TGATGAGATGGACGAGGACGAGGCCGACGATGCCCCTCTGCTACCGCGCGGTGACCACCAAGGAGAAGACGAGGG
CGACGGCCAGCAGCACGCACGTCTGCGCCGACGGCTTCACGACCTCTCAGTCTACAAGCCCTCGTCGCACCTCTT
CGTCGCCGGCGACCTCAACTACCGTATCGCCACGACGCCGCCTCCGCCCGGCGCGGCGCTGCCGAGCCTCGACCG
GCGATCGCATCATCACTTCGGAGCCTTCTTGCCGTTGGATCAGCTGACGCGCGAGAGGCGGGCCGGCAGGACGCT
GCACGGGTTGGTGGAAGCGCCGGTGGAATTTCCGCCGACATACAAGTATGTGCCTCTGGGGGACAAGGCACATGA
TAACGAGGACGACGATGGTGGCTTTTGCGACGAGAGGCAGCATTACGAGGACGAGGACGGGGACGAGGATGAAGA
CAAGGACGTGGTTCGTTGGCGTTTCGCCTCTCATCGCTGGCCGGCCTGGACGGATCGAATTCTCTACCTCGACGT
GCCGCCGTGGGTACGGGCGCAGAACGGTCCGCGGATCCGAGTGCGCGCATACGACGCCCTGCCCGTGGTGCGGAC
GAGCGATCACCGGGCCGTCTTCCTACGCGTCGACGTGCCCCTCGTCGGACCGAGGGAACTCGCGCCTCCGTCCTC
ACTCTCGTCTGACGTGACGTCGCCGCCATCTTGGGCGCACGATGCCACGGCCACGGACCCTCGTCTCCGGCTCCC
CGTCGAGATCGACCCGGAGGCCTGGGCGCGACGAAGGGCGGCGCGGCAGAAGGAGAAGCTGGTCGGTTGGACGAT
GCTCCTCTGGAGTTCGAGCGAGGGGGCTTGGGTGCTACTCGCCTCGTTGGTAGTTGCCGCGGGAGGGGCGTATTG
GTTTTACTATTCCGGGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail