Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1505
Gene name
Locationscaffold_153:24064..24971
Strand-
Gene length (bp)907
Transcript length (bp)786
Coding sequence length (bp)783
Protein length (aa) 261

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5407 0.3297 0.3636 0.0765 0.1511 0.0458 0.1054 0.1125 0.1368 0.0203

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup5166
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|960
Ophiocordyceps australis map64 (Brazil) OphauB2|5094
Ophiocordyceps camponoti-floridani Ophcf2|05889
Ophiocordyceps camponoti-rufipedis Ophun1|384
Ophiocordyceps kimflemingae Ophio5|1505 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3740

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1505
MTLNLPDVERVQLSLTPQQDVGSAATDVSNDHGTPNMLLLAYTDLVPIDSATDLNSMREDFQTWNAWELGQAEVQ
VDGHVKAGDLPADDSIVSRIARTNFRSKAIEFFRATSQAWLVPTDNFTVKRPVEATEASANGAISSELQSLVKES
QLQDQFGVGLHTIKDRVDVKTENKYFFTHLVYQYNRSSKTIRPVVRDISFIVKKAGEKKSGNKVAVEIAFTAMTY
DFDLTFWRGNRHKGAAAIKKGEPIRKQMSFDFLNFE
Coding >Ophio5|1505
ATGACTCTAAACCTCCCCGATGTGGAGCGCGTCCAGCTCAGCTTGACACCCCAACAGGATGTCGGGTCCGCGGCC
ACAGACGTGTCTAATGACCATGGCACCCCAAATATGCTCCTACTTGCCTACACAGACCTTGTTCCCATCGATAGT
GCAACAGATTTGAACTCCATGCGAGAAGATTTCCAGACCTGGAATGCATGGGAACTCGGACAAGCAGAAGTTCAG
GTCGACGGCCACGTTAAGGCCGGCGACCTACCGGCTGACGACTCAATTGTCTCTCGCATCGCCAGAACCAATTTT
CGTTCCAAGGCGATCGAATTTTTCAGGGCAACTAGTCAAGCTTGGCTCGTACCTACAGATAACTTCACTGTCAAG
AGACCCGTTGAAGCTACGGAAGCTAGTGCTAACGGCGCCATCTCTTCTGAACTACAATCACTTGTGAAGGAGAGC
CAACTCCAAGACCAATTTGGTGTCGGCCTTCATACAATCAAAGACAGAGTCGACGTGAAGACGGAAAATAAATAT
TTCTTCACACACCTAGTCTATCAGTATAATCGCAGCTCGAAAACGATCCGACCAGTTGTTCGGGACATTTCATTC
ATCGTGAAGAAAGCCGGGGAAAAGAAAAGCGGTAATAAAGTCGCGGTCGAGATTGCTTTTACTGCTATGACTTAC
GATTTTGATCTAACATTTTGGAGAGGAAATCGACATAAGGGGGCGGCAGCCATAAAAAAAGGAGAACCCATTCGC
AAACAAATGTCGTTTGACTTCTTGAACTTTGAA
Transcript >Ophio5|1505
ATGACTCTAAACCTCCCCGATGTGGAGCGCGTCCAGCTCAGCTTGACACCCCAACAGGATGTCGGGTCCGCGGCC
ACAGACGTGTCTAATGACCATGGCACCCCAAATATGCTCCTACTTGCCTACACAGACCTTGTTCCCATCGATAGT
GCAACAGATTTGAACTCCATGCGAGAAGATTTCCAGACCTGGAATGCATGGGAACTCGGACAAGCAGAAGTTCAG
GTCGACGGCCACGTTAAGGCCGGCGACCTACCGGCTGACGACTCAATTGTCTCTCGCATCGCCAGAACCAATTTT
CGTTCCAAGGCGATCGAATTTTTCAGGGCAACTAGTCAAGCTTGGCTCGTACCTACAGATAACTTCACTGTCAAG
AGACCCGTTGAAGCTACGGAAGCTAGTGCTAACGGCGCCATCTCTTCTGAACTACAATCACTTGTGAAGGAGAGC
CAACTCCAAGACCAATTTGGTGTCGGCCTTCATACAATCAAAGACAGAGTCGACGTGAAGACGGAAAATAAATAT
TTCTTCACACACCTAGTCTATCAGTATAATCGCAGCTCGAAAACGATCCGACCAGTTGTTCGGGACATTTCATTC
ATCGTGAAGAAAGCCGGGGAAAAGAAAAGCGGTAATAAAGTCGCGGTCGAGATTGCTTTTACTGCTATGACTTAC
GATTTTGATCTAACATTTTGGAGAGGAAATCGACATAAGGGGGCGGCAGCCATAAAAAAAGGAGAACCCATTCGC
AAACAAATGTCGTTTGACTTCTTGAACTTTGAATAG
Gene >Ophio5|1505
ATGACTCTAAACCTCCCCGATGTGGAGCGCGTCCAGCTCAGCTTGACACCCCAACAGGATGTCGGGTCCGCGGCC
ACAGACGTGTCTAATGACCATGGCACCCCAAATATGCTCCTACTTGCCTACACAGACCTTGTTCCCATCGATAGT
GCAACAGATTTGAACTCCATGCGAGAAGATTTCCAGACCTGGAATGCATGGGAACTCGGACAAGCAGAAGTTCAG
GTCGACGGCCACGTTAAGGCCGGCGACCTACCGGCTGACGACTCAATTGTCTCTCGCATCGCCAGAACCAATTTT
CGTTCCAAGGCGATCGAATTTTTCAGGGCAACTAGTCAAGCTTGGTATGTCCCCTACTCGTCTTACGTTGAACTG
GGCTGAAGAGTCTCACTGGCGATTGTTCAATTCCAAGGCTCGTACCTACAGATAACTTCACTGTCAAGAGACCCG
TTGAAGCTACGGAAGCTAGTGCTAACGGCGCCATCTCTTCTGAACTACAATCACTTGTGAAGGAGAGCCAACTCC
AAGACCAATTTGGTGTCGGCCTTCATACAATCAAAGACAGAGTCGACGTGAAGACGGAAAATAAATATTTCTTCA
CACACCTAGTCTATCAGTATAATCGCAGCTCGAAAACGATCCGACCAGGTGATATTTCTTGTGGCAAACTGAGAC
CCCTCGATCACTAACTCTATCGCCAGTTGTTCGGGACATTTCATTCATCGTGAAGAAAGCCGGGGAAAAGAAAAG
CGGTAATAAAGTCGCGGTCGAGATTGCTTTTACTGCTATGACTTACGATTTTGATCTAACATTTTGGAGAGGAAA
TCGACATAAGGGGGCGGCAGCCATAAAAAAAGGAGAACCCATTCGCAAACAAATGTCGTTTGACTTCTTGAACTT
TGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail