Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1502
Gene name
Locationscaffold_153:10749..14823
Strand+
Gene length (bp)4074
Transcript length (bp)3957
Coding sequence length (bp)3954
Protein length (aa) 1318

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12796 Ank_2 Ankyrin repeats (3 copies) 1.9E-06 715 804
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.2E-06 1002 1089
PF13606 Ank_3 Ankyrin repeat 2.5E-03 826 852
PF13857 Ank_5 Ankyrin repeats (many copies) 4.3E-07 1188 1229
PF00069 Pkinase Protein kinase domain 5.9E-21 103 292
PF07714 PK_Tyr_Ser-Thr Protein tyrosine and serine/threonine kinase 2.8E-19 103 295

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 115 292 3.0E-12
sp|Q8VZJ9|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana GN=CRCK2 PE=2 SV=1 99 285 2.0E-11
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 96 285 2.0E-11
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 138 300 2.0E-11
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 59 323 5.0E-11
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q55CY9|GDT8_DICDI Probable serine/threonine-protein kinase gdt8 OS=Dictyostelium discoideum GN=gdt8 PE=3 SV=1 115 292 3.0E-12
sp|Q8VZJ9|CRCK2_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 2 OS=Arabidopsis thaliana GN=CRCK2 PE=2 SV=1 99 285 2.0E-11
sp|Q9FIL7|CRCK1_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 1 OS=Arabidopsis thaliana GN=CRCK1 PE=1 SV=1 96 285 2.0E-11
sp|Q8XJL8|PKN2_CLOPE Probable serine/threonine-protein kinase CPE1738 OS=Clostridium perfringens (strain 13 / Type A) GN=CPE1738 PE=3 SV=1 138 300 2.0E-11
sp|Q9SR05|ANX1_ARATH Receptor-like protein kinase ANXUR1 OS=Arabidopsis thaliana GN=ANX1 PE=2 SV=1 59 323 5.0E-11
sp|Q2MHE4|HT1_ARATH Serine/threonine-protein kinase HT1 OS=Arabidopsis thaliana GN=HT1 PE=1 SV=1 139 281 8.0E-11
sp|Q54XQ2|RCKA_DICDI RGS domain-containing serine/threonine-protein kinase A OS=Dictyostelium discoideum GN=rckA PE=1 SV=1 168 291 8.0E-11
sp|Q67E01|DUSTY_XENLA Dual serine/threonine and tyrosine protein kinase OS=Xenopus laevis GN=dstyk PE=2 SV=1 121 321 8.0E-10
sp|Q67E00|DUSTY_XENTR Dual serine/threonine and tyrosine protein kinase OS=Xenopus tropicalis GN=dstyk PE=2 SV=1 121 321 1.0E-09
sp|Q97IC2|PKN2_CLOAB Probable serine/threonine-protein kinase CA_C1728 OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=CA_C1728 PE=3 SV=1 165 361 1.0E-09
sp|Q9ASQ5|CRCK3_ARATH Calmodulin-binding receptor-like cytoplasmic kinase 3 OS=Arabidopsis thaliana GN=CRCK3 PE=2 SV=1 103 285 1.0E-09
sp|Q6XUX2|DUSTY_RAT Dual serine/threonine and tyrosine protein kinase OS=Rattus norvegicus GN=Dstyk PE=2 SV=1 121 281 2.0E-09
sp|O64556|Y2923_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g19230 OS=Arabidopsis thaliana GN=At2g19230 PE=3 SV=3 139 285 2.0E-09
sp|Q8BZ25|ANKK1_MOUSE Ankyrin repeat and protein kinase domain-containing protein 1 OS=Mus musculus GN=Ankk1 PE=2 SV=1 937 1236 3.0E-09
sp|D7UPN3|CERK1_ORYSJ Chitin elicitor receptor kinase 1 OS=Oryza sativa subsp. japonica GN=CERK1 PE=1 SV=1 123 285 3.0E-09
sp|O22558|STY8_ARATH Serine/threonine-protein kinase STY8 OS=Arabidopsis thaliana GN=STY8 PE=1 SV=2 81 291 4.0E-09
sp|P00528|SRC64_DROME Tyrosine-protein kinase Src64B OS=Drosophila melanogaster GN=Src64B PE=1 SV=3 165 293 4.0E-09
sp|Q6XUX1|DUSTY_MOUSE Dual serine/threonine and tyrosine protein kinase OS=Mus musculus GN=Dstyk PE=1 SV=1 121 281 4.0E-09
sp|Q4TVR5|DUSTY_BOVIN Dual serine/threonine and tyrosine protein kinase OS=Bos taurus GN=DSTYK PE=2 SV=1 121 295 4.0E-09
sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 139 285 4.0E-09
sp|Q20CR4|DUSTY_MACMU Dual serine/threonine and tyrosine protein kinase OS=Macaca mulatta GN=DSTYK PE=2 SV=1 121 295 5.0E-09
sp|Q4VSN4|DUSTY_CANLF Dual serine/threonine and tyrosine protein kinase OS=Canis lupus familiaris GN=DSTYK PE=2 SV=1 121 295 5.0E-09
sp|Q4VSN5|DUSTY_PANTR Dual serine/threonine and tyrosine protein kinase OS=Pan troglodytes GN=DSTYK PE=2 SV=1 121 295 5.0E-09
sp|Q6XUX3|DUSTY_HUMAN Dual serine/threonine and tyrosine protein kinase OS=Homo sapiens GN=DSTYK PE=1 SV=2 121 295 5.0E-09
sp|Q6XUX0|DUSTY_CHICK Dual serine/threonine and tyrosine protein kinase OS=Gallus gallus GN=DSTYK PE=2 SV=1 121 281 1.0E-08
sp|Q9SI06|Y5573_ARATH Putative leucine-rich repeat receptor-like serine/threonine-protein kinase At2g04300 OS=Arabidopsis thaliana GN=At2g04300 PE=3 SV=2 103 285 1.0E-08
sp|Q55GE6|ROCO7_DICDI Probable serine/threonine-protein kinase roco7 OS=Dictyostelium discoideum GN=roco7 PE=3 SV=1 23 353 1.0E-08
sp|C0LGG3|Y5182_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51820 OS=Arabidopsis thaliana GN=At1g51820 PE=2 SV=1 139 285 1.0E-08
sp|Q6P6U0|FGR_RAT Tyrosine-protein kinase Fgr OS=Rattus norvegicus GN=Fgr PE=1 SV=1 103 293 1.0E-08
sp|Q9FZB8|Y5181_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51810 OS=Arabidopsis thaliana GN=At1g51810 PE=2 SV=1 139 281 2.0E-08
sp|Q15569|TESK1_HUMAN Dual specificity testis-specific protein kinase 1 OS=Homo sapiens GN=TESK1 PE=1 SV=2 139 306 2.0E-08
sp|Q9FZB1|Y5188_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51880 OS=Arabidopsis thaliana GN=At1g51880 PE=2 SV=1 121 285 2.0E-08
sp|Q9FMD7|Y5659_ARATH Probable inactive receptor kinase At5g16590 OS=Arabidopsis thaliana GN=At5g16590 PE=1 SV=1 123 285 2.0E-08
sp|Q9M8T0|Y3288_ARATH Probable inactive receptor kinase At3g02880 OS=Arabidopsis thaliana GN=At3g02880 PE=1 SV=1 138 285 2.0E-08
sp|O70146|TESK1_MOUSE Dual specificity testis-specific protein kinase 1 OS=Mus musculus GN=Tesk1 PE=1 SV=3 139 306 2.0E-08
sp|Q9LIG2|RLK6_ARATH Receptor-like protein kinase At3g21340 OS=Arabidopsis thaliana GN=At3g21340 PE=1 SV=1 121 285 2.0E-08
sp|C0LGT5|Y5169_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g16900 OS=Arabidopsis thaliana GN=At5g16900 PE=2 SV=1 164 285 3.0E-08
sp|Q7T6Y2|YR831_MIMIV Putative serine/threonine-protein kinase/receptor R831 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R831 PE=3 SV=2 97 285 3.0E-08
sp|Q91743|FGFR4_XENLA Fibroblast growth factor receptor 4 OS=Xenopus laevis GN=fgfr4 PE=2 SV=1 103 296 3.0E-08
sp|Q3E8W4|ANX2_ARATH Receptor-like protein kinase ANXUR2 OS=Arabidopsis thaliana GN=ANX2 PE=2 SV=1 103 285 3.0E-08
sp|C0LGR6|Y4291_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g29180 OS=Arabidopsis thaliana GN=At4g29180 PE=2 SV=2 164 281 3.0E-08
sp|Q108U6|MET_LOXAF Hepatocyte growth factor receptor OS=Loxodonta africana GN=MET PE=3 SV=1 138 293 4.0E-08
sp|Q4VSN3|DUSTY_TETNG Dual serine/threonine and tyrosine protein kinase OS=Tetraodon nigroviridis GN=dstyk PE=2 SV=1 121 319 4.0E-08
sp|O42127|FGFR3_XENLA Fibroblast growth factor receptor 3 OS=Xenopus laevis GN=fgfr3 PE=2 SV=1 103 296 4.0E-08
sp|C0LGD9|Y1756_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g07560 OS=Arabidopsis thaliana GN=At1g07560 PE=2 SV=1 97 285 4.0E-08
sp|Q8RWL6|STY17_ARATH Serine/threonine-protein kinase STY17 OS=Arabidopsis thaliana GN=STY17 PE=1 SV=1 95 285 5.0E-08
sp|Q2QLE0|MET_PIG Hepatocyte growth factor receptor OS=Sus scrofa GN=MET PE=2 SV=1 138 293 5.0E-08
sp|Q07E01|MET_ORNAN Hepatocyte growth factor receptor OS=Ornithorhynchus anatinus GN=MET PE=3 SV=1 138 293 5.0E-08
sp|Q2IBC0|MET_RHIFE Hepatocyte growth factor receptor OS=Rhinolophus ferrumequinum GN=MET PE=3 SV=1 138 293 5.0E-08
sp|Q2QLC0|MET_CALMO Hepatocyte growth factor receptor OS=Callicebus moloch GN=MET PE=3 SV=1 138 293 6.0E-08
sp|Q09YL1|MET_ATEGE Hepatocyte growth factor receptor OS=Ateles geoffroyi GN=MET PE=3 SV=1 138 293 6.0E-08
sp|Q07DY1|MET_NOMLE Hepatocyte growth factor receptor OS=Nomascus leucogenys GN=MET PE=3 SV=1 138 293 6.0E-08
sp|Q2IBD8|MET_PONAB Hepatocyte growth factor receptor OS=Pongo abelii GN=MET PE=3 SV=1 138 293 6.0E-08
sp|Q2IBF2|MET_GORGO Hepatocyte growth factor receptor OS=Gorilla gorilla gorilla GN=MET PE=3 SV=1 138 293 6.0E-08
sp|Q2QLF1|MET_PANTR Hepatocyte growth factor receptor OS=Pan troglodytes GN=MET PE=3 SV=1 138 293 6.0E-08
sp|C0LGP2|MEE39_ARATH Probable LRR receptor-like serine/threonine-protein kinase MEE39 OS=Arabidopsis thaliana GN=MEE39 PE=2 SV=1 121 285 6.0E-08
sp|Q9SA72|Y1357_ARATH Probable receptor-like protein kinase At1g30570 OS=Arabidopsis thaliana GN=At1g30570 PE=3 SV=1 96 353 6.0E-08
sp|P08581|MET_HUMAN Hepatocyte growth factor receptor OS=Homo sapiens GN=MET PE=1 SV=4 138 293 6.0E-08
sp|P16056|MET_MOUSE Hepatocyte growth factor receptor OS=Mus musculus GN=Met PE=1 SV=1 138 293 6.0E-08
sp|Q2IBA6|MET_CHLAE Hepatocyte growth factor receptor OS=Chlorocebus aethiops GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q9LFV3|Y5157_ARATH Probable leucine-rich repeat receptor-like serine/threonine-protein kinase At5g15730 OS=Arabidopsis thaliana GN=At5g15730 PE=2 SV=1 165 373 7.0E-08
sp|Q2IBG7|MET_EULMM Hepatocyte growth factor receptor OS=Eulemur macaco macaco GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q2QL89|MET_MICMU Hepatocyte growth factor receptor OS=Microcebus murinus GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q09YH7|MET_SAIBB Hepatocyte growth factor receptor OS=Saimiri boliviensis boliviensis GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q9LT96|Y5977_ARATH Probable leucine-rich repeat receptor-like protein kinase At5g49770 OS=Arabidopsis thaliana GN=At5g49770 PE=2 SV=1 123 285 7.0E-08
sp|Q07DV8|MET_AOTNA Hepatocyte growth factor receptor OS=Aotus nancymaae GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q07DZ1|MET_COLGU Hepatocyte growth factor receptor OS=Colobus guereza GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q09YN5|MET_RABIT Hepatocyte growth factor receptor OS=Oryctolagus cuniculus GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q2QLH6|MET_OTOGA Hepatocyte growth factor receptor OS=Otolemur garnettii GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q07E24|MET_MUSPF Hepatocyte growth factor receptor OS=Mustela putorius furo GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q07E48|MET_DASNO Hepatocyte growth factor receptor OS=Dasypus novemcinctus GN=MET PE=3 SV=1 138 293 7.0E-08
sp|C0LGL4|Y2289_ARATH Probable LRR receptor-like serine/threonine-protein kinase At2g28960 OS=Arabidopsis thaliana GN=At2g28960 PE=2 SV=1 164 285 7.0E-08
sp|Q2QLG5|MET_CALJA Hepatocyte growth factor receptor OS=Callithrix jacchus GN=MET PE=3 SV=1 138 293 7.0E-08
sp|A0M8R7|MET_PAPAN Hepatocyte growth factor receptor OS=Papio anubis GN=MET PE=3 SV=1 138 293 7.0E-08
sp|Q63572|TESK1_RAT Dual specificity testis-specific protein kinase 1 OS=Rattus norvegicus GN=Tesk1 PE=1 SV=1 139 353 7.0E-08
sp|Q1L6Q1|DUSTY_APIME Dual serine/threonine and tyrosine protein kinase OS=Apis mellifera GN=DSTYK PE=2 SV=1 184 281 8.0E-08
sp|Q2QLA9|MET_HORSE Hepatocyte growth factor receptor OS=Equus caballus GN=MET PE=3 SV=1 138 293 8.0E-08
sp|Q75ZY9|MET_CANLF Hepatocyte growth factor receptor OS=Canis lupus familiaris GN=MET PE=1 SV=1 138 293 8.0E-08
sp|Q4VSN2|DUSTY_TAKRU Dual serine/threonine and tyrosine protein kinase OS=Takifugu rubripes GN=dstyk PE=2 SV=1 121 281 8.0E-08
sp|Q07E37|MET_NEONE Hepatocyte growth factor receptor OS=Neofelis nebulosa GN=MET PE=3 SV=1 138 293 8.0E-08
sp|A0M8S8|MET_FELCA Hepatocyte growth factor receptor OS=Felis catus GN=MET PE=3 SV=1 138 293 8.0E-08
sp|A1X150|MET_ECHTE Hepatocyte growth factor receptor OS=Echinops telfairi GN=MET PE=3 SV=1 138 293 9.0E-08
sp|Q9SV05|CCR35_ARATH Serine/threonine-protein kinase-like protein At3g51990 OS=Arabidopsis thaliana GN=At3g51990 PE=2 SV=1 81 285 1.0E-07
sp|C0LGJ1|Y1743_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g74360 OS=Arabidopsis thaliana GN=At1g74360 PE=2 SV=1 99 353 1.0E-07
sp|P97523|MET_RAT Hepatocyte growth factor receptor OS=Rattus norvegicus GN=Met PE=1 SV=1 138 293 1.0E-07
sp|Q00PJ8|MET_ATEAB Hepatocyte growth factor receptor OS=Atelerix albiventris GN=MET PE=3 SV=1 138 293 1.0E-07
sp|Q7YRC6|AURKB_BOVIN Aurora kinase B OS=Bos taurus GN=AURKB PE=2 SV=1 125 285 1.0E-07
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 139 285 1.0E-07
sp|Q502K3|ANR52_DANRE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Danio rerio GN=ankrd52 PE=2 SV=1 771 1227 1.0E-07
sp|O49318|Y2317_ARATH Probable leucine-rich repeat receptor-like protein kinase At2g33170 OS=Arabidopsis thaliana GN=At2g33170 PE=2 SV=1 129 297 1.0E-07
sp|Q03002|FRK1_YEAST Fatty acyl-CoA synthetase and RNA processing-associated kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRK1 PE=1 SV=1 88 355 1.0E-07
sp|Q9T020|Y4391_ARATH Probable receptor-like protein kinase At4g39110 OS=Arabidopsis thaliana GN=At4g39110 PE=3 SV=1 103 315 1.0E-07
sp|Q9SJT0|Y2214_ARATH Probable receptor-like protein kinase At2g21480 OS=Arabidopsis thaliana GN=At2g21480 PE=3 SV=1 103 315 1.0E-07
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8 OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1 164 281 1.0E-07
sp|Q9TZM3|LRK1_CAEEL Leucine-rich repeat serine/threonine-protein kinase 1 OS=Caenorhabditis elegans GN=lrk-1 PE=1 SV=6 139 353 2.0E-07
sp|O22187|Y2232_ARATH Probable receptor-like protein kinase At2g23200 OS=Arabidopsis thaliana GN=At2g23200 PE=3 SV=1 165 304 2.0E-07
sp|Q9SCZ4|FERON_ARATH Receptor-like protein kinase FERONIA OS=Arabidopsis thaliana GN=FER PE=1 SV=1 165 285 2.0E-07
sp|Q9VUX2|MIB_DROME E3 ubiquitin-protein ligase mind-bomb OS=Drosophila melanogaster GN=mib1 PE=1 SV=3 996 1278 2.0E-07
sp|Q26614|FGFR_STRPU Fibroblast growth factor receptor OS=Strongylocentrotus purpuratus GN=FGFR PE=2 SV=1 103 366 2.0E-07
sp|A1A5H8|YES_DANRE Tyrosine-protein kinase yes OS=Danio rerio GN=yes1 PE=1 SV=1 97 293 2.0E-07
sp|Q4VSN1|DUSTY_DANRE Dual serine/threonine and tyrosine protein kinase OS=Danio rerio GN=dstyk PE=2 SV=1 67 319 2.0E-07
sp|P18460|FGFR3_CHICK Fibroblast growth factor receptor 3 OS=Gallus gallus GN=FGFR3 PE=2 SV=1 103 296 2.0E-07
sp|O65924|Y2921_ARATH Putative leucine-rich repeat receptor-like protein kinase At2g19210 OS=Arabidopsis thaliana GN=At2g19210 PE=3 SV=1 164 285 2.0E-07
sp|Q01919|KIN4_YEAST Serine/threonine-protein kinase KIN4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=KIN4 PE=1 SV=1 57 355 2.0E-07
sp|O65238|Y5537_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase At5g35370 OS=Arabidopsis thaliana GN=At5g35370 PE=2 SV=2 165 281 2.0E-07
sp|Q39202|RLK1_ARATH G-type lectin S-receptor-like serine/threonine-protein kinase RLK1 OS=Arabidopsis thaliana GN=RLK1 PE=2 SV=2 139 285 2.0E-07
sp|P22607|FGFR3_HUMAN Fibroblast growth factor receptor 3 OS=Homo sapiens GN=FGFR3 PE=1 SV=1 103 296 2.0E-07
sp|Q91287|FGFR3_PLEWA Fibroblast growth factor receptor 3 OS=Pleurodeles waltl GN=FGFR3 PE=2 SV=1 103 296 2.0E-07
sp|Q9SNA3|Y3463_ARATH Putative receptor-like protein kinase At3g46340 OS=Arabidopsis thaliana GN=At3g46340 PE=3 SV=1 121 285 2.0E-07
sp|Q6XHA5|ROC11_DICDI Probable serine/threonine-protein kinase roco11 OS=Dictyostelium discoideum GN=roco11 PE=3 SV=1 111 355 3.0E-07
sp|Q498D6|FGFR4_RAT Fibroblast growth factor receptor 4 OS=Rattus norvegicus GN=Fgfr4 PE=1 SV=1 103 296 3.0E-07
sp|Q02357|ANK1_MOUSE Ankyrin-1 OS=Mus musculus GN=Ank1 PE=1 SV=2 701 1232 3.0E-07
sp|P14234|FGR_MOUSE Tyrosine-protein kinase Fgr OS=Mus musculus GN=Fgr PE=1 SV=2 103 293 3.0E-07
sp|Q9FID8|Y5900_ARATH Putative receptor-like protein kinase At5g39000 OS=Arabidopsis thaliana GN=At5g39000 PE=3 SV=1 123 285 3.0E-07
sp|A2CI35|DUSTY_STRPU Dual serine/threonine and tyrosine protein kinase OS=Strongylocentrotus purpuratus GN=DSTYK PE=2 SV=1 189 295 3.0E-07
sp|Q9LK35|THE1_ARATH Receptor-like protein kinase THESEUS 1 OS=Arabidopsis thaliana GN=THE1 PE=1 SV=1 103 323 3.0E-07
sp|B2RXR6|ANR44_MOUSE Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Mus musculus GN=Ankrd44 PE=1 SV=1 742 1098 3.0E-07
sp|Q7RZD3|STE20_NEUCR Serine/threonine-protein kinase ste20 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=stk-4 PE=3 SV=1 124 296 3.0E-07
sp|Q5S006|LRRK2_MOUSE Leucine-rich repeat serine/threonine-protein kinase 2 OS=Mus musculus GN=Lrrk2 PE=1 SV=2 127 353 3.0E-07
sp|Q9FID9|Y5389_ARATH Probable receptor-like protein kinase At5g38990 OS=Arabidopsis thaliana GN=At5g38990 PE=2 SV=1 164 285 4.0E-07
sp|P10936|YES_XENLA Tyrosine-protein kinase Yes OS=Xenopus laevis GN=yes1 PE=2 SV=3 97 293 4.0E-07
sp|P27447|YES_XIPHE Tyrosine-protein kinase Yes OS=Xiphophorus helleri GN=yes PE=2 SV=3 97 293 4.0E-07
sp|Q6DE08|AUKBA_XENLA Aurora kinase B-A OS=Xenopus laevis GN=aurkb-a PE=1 SV=1 125 285 4.0E-07
sp|Q90413|FGFR4_DANRE Fibroblast growth factor receptor 4 OS=Danio rerio GN=fgfr4 PE=1 SV=1 103 296 5.0E-07
sp|Q9I8X3|FGFR3_DANRE Fibroblast growth factor receptor 3 OS=Danio rerio GN=fgfr3 PE=2 SV=1 103 296 5.0E-07
sp|Q54G43|SHKE_DICDI Dual specificity protein kinase shkE OS=Dictyostelium discoideum GN=shkE PE=3 SV=1 129 284 5.0E-07
sp|Q9LX29|ACR4L_ARATH Serine/threonine-protein kinase-like protein ACR4 OS=Arabidopsis thaliana GN=ACR4 PE=1 SV=1 115 285 5.0E-07
sp|Q09701|AKR1_SCHPO Palmitoyltransferase akr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=akr1 PE=3 SV=1 745 854 5.0E-07
sp|Q9FLW0|Y5241_ARATH Probable receptor-like protein kinase At5g24010 OS=Arabidopsis thaliana GN=At5g24010 PE=1 SV=1 103 285 5.0E-07
sp|Q02977|YRK_CHICK Proto-oncogene tyrosine-protein kinase Yrk OS=Gallus gallus GN=YRK PE=2 SV=2 66 293 5.0E-07
sp|F4JTP5|STY46_ARATH Serine/threonine-protein kinase STY46 OS=Arabidopsis thaliana GN=STY46 PE=1 SV=1 58 301 6.0E-07
sp|Q9J502|V233_FOWPN Putative ankyrin repeat protein FPV233 OS=Fowlpox virus (strain NVSL) GN=FPV233 PE=3 SV=1 1003 1089 6.0E-07
sp|C0LGW2|PAM74_ARATH Probable LRR receptor-like serine/threonine-protein kinase PAM74 OS=Arabidopsis thaliana GN=PAM74 PE=2 SV=1 139 285 6.0E-07
sp|Q6GPL3|AUKBB_XENLA Aurora kinase B-B OS=Xenopus laevis GN=aurkb-b PE=2 SV=1 125 285 6.0E-07
sp|Q5S007|LRRK2_HUMAN Leucine-rich repeat serine/threonine-protein kinase 2 OS=Homo sapiens GN=LRRK2 PE=1 SV=2 127 353 7.0E-07
sp|P63185|SRC_RSVSE Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain Schmidt-Ruppin E) GN=V-SRC PE=1 SV=3 97 293 8.0E-07
sp|P9WI81|PKNB_MYCTU Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pknB PE=1 SV=1 148 380 8.0E-07
sp|P9WI80|PKNB_MYCTO Serine/threonine-protein kinase PknB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pknB PE=3 SV=1 148 380 8.0E-07
sp|P0A5S5|PKNB_MYCBO Serine/threonine-protein kinase PknB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pknB PE=3 SV=1 148 380 8.0E-07
sp|C0LGG4|Y1518_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g51860 OS=Arabidopsis thaliana GN=At1g51860 PE=2 SV=2 121 285 8.0E-07
sp|Q9XA16|PKNX_STRCO Probable serine/threonine-protein kinase SCO3848 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO3848 PE=3 SV=1 146 360 9.0E-07
sp|A4IGM9|AURKB_XENTR Aurora kinase B OS=Xenopus tropicalis GN=aurkb PE=2 SV=1 125 285 9.0E-07
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2 101 281 9.0E-07
sp|A2CI34|DUSTY_PIMPR Dual serine/threonine and tyrosine protein kinase OS=Pimephales promelas GN=dstyk PE=2 SV=1 67 281 9.0E-07
sp|Q7T6X2|YR826_MIMIV Putative serine/threonine-protein kinase/receptor R826 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R826 PE=3 SV=2 139 285 1.0E-06
sp|P25020|SRC_RSVH1 Tyrosine-protein kinase transforming protein Src OS=Rous sarcoma virus (strain H-19) GN=V-SRC PE=1 SV=3 97 293 1.0E-06
sp|O59790|ARK1_SCHPO Serine/threonine-protein kinase ark1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ark1 PE=1 SV=2 126 285 1.0E-06
sp|Q91285|FGFR1_PLEWA Fibroblast growth factor receptor 1 OS=Pleurodeles waltl GN=FGFR1 PE=2 SV=1 103 296 1.0E-06
sp|P21804|FGFR1_CHICK Fibroblast growth factor receptor 1 OS=Gallus gallus GN=FGFR1 PE=2 SV=1 103 296 1.0E-06
sp|P42680|TEC_HUMAN Tyrosine-protein kinase Tec OS=Homo sapiens GN=TEC PE=1 SV=2 138 288 1.0E-06
sp|D4AE59|STK11_RAT Serine/threonine-protein kinase STK11 OS=Rattus norvegicus GN=Stk11 PE=1 SV=1 118 293 1.0E-06
sp|Q9SHI2|Y1723_ARATH Leucine-rich repeat receptor-like serine/threonine-protein kinase At1g17230 OS=Arabidopsis thaliana GN=At1g17230 PE=2 SV=2 139 353 1.0E-06
sp|P09324|YES_CHICK Tyrosine-protein kinase Yes OS=Gallus gallus GN=YES1 PE=1 SV=3 97 293 1.0E-06
sp|P0C5E2|Y1839_ARATH Probable serine/threonine-protein kinase At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=2 SV=2 165 285 1.0E-06
sp|Q9LK43|TMK4_ARATH Receptor-like kinase TMK4 OS=Arabidopsis thaliana GN=TMK4 PE=1 SV=1 121 297 1.0E-06
sp|Q91288|FGFR4_PLEWA Fibroblast growth factor receptor 4 OS=Pleurodeles waltl GN=FGFR4 PE=2 SV=1 103 296 2.0E-06
sp|Q54RZ7|Y1199_DICDI Probable serine/threonine-protein kinase DDB_G0282895 OS=Dictyostelium discoideum GN=DDB_G0282895 PE=3 SV=1 165 281 2.0E-06
sp|C0LGF5|Y1341_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g34110 OS=Arabidopsis thaliana GN=At1g34110 PE=2 SV=2 101 377 2.0E-06
sp|Q55A09|Y9963_DICDI Probable serine/threonine-protein kinase DDB_G0272254 OS=Dictyostelium discoideum GN=DDB_G0272254 PE=3 SV=1 97 285 2.0E-06
sp|Q9YI66|TYRO3_DANRE Tyrosine-protein kinase receptor TYRO3 OS=Danio rerio GN=tyro3 PE=2 SV=1 139 293 2.0E-06
sp|P43637|TOS3_YEAST Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOS3 PE=1 SV=1 124 240 2.0E-06
sp|A6ZU08|TOS3_YEAS7 Serine/threonine-protein kinase TOS3 OS=Saccharomyces cerevisiae (strain YJM789) GN=TOS3 PE=3 SV=1 124 240 2.0E-06
sp|C0LGV0|Y5487_ARATH Probable LRR receptor-like serine/threonine-protein kinase At5g48740 OS=Arabidopsis thaliana GN=At5g48740 PE=2 SV=1 134 281 2.0E-06
sp|Q55EC7|GEFX_DICDI RasGEF domain-containing serine/threonine-protein kinase X OS=Dictyostelium discoideum GN=gefX PE=2 SV=1 115 320 2.0E-06
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=Arabidopsis thaliana GN=WAKL2 PE=2 SV=1 101 285 2.0E-06
sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 124 296 2.0E-06
sp|Q9FLJ8|Y5613_ARATH Probable receptor-like protein kinase At5g61350 OS=Arabidopsis thaliana GN=At5g61350 PE=2 SV=1 122 315 2.0E-06
sp|P50118|MOS_PIG Proto-oncogene serine/threonine-protein kinase mos OS=Sus scrofa GN=MOS PE=2 SV=1 139 291 2.0E-06
sp|Q04736|YES_MOUSE Tyrosine-protein kinase Yes OS=Mus musculus GN=Yes1 PE=1 SV=3 97 293 3.0E-06
sp|P00527|YES_AVISY Tyrosine-protein kinase transforming protein Yes (Fragment) OS=Avian sarcoma virus (strain Y73) GN=V-YES PE=3 SV=2 118 293 3.0E-06
sp|Q23915|KINX_DICDI Probable serine/threonine-protein kinase kinX OS=Dictyostelium discoideum GN=kinX PE=3 SV=2 192 285 3.0E-06
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=Arabidopsis thaliana GN=WAKL1 PE=2 SV=1 101 281 3.0E-06
sp|Q9S9M3|WAKLC_ARATH Wall-associated receptor kinase-like 3 OS=Arabidopsis thaliana GN=WAKL3 PE=2 SV=2 101 281 3.0E-06
sp|P54744|PKNB_MYCLE Serine/threonine-protein kinase PknB OS=Mycobacterium leprae (strain TN) GN=pknB PE=3 SV=3 148 317 3.0E-06
sp|A8R7E6|CERK1_ARATH Chitin elicitor receptor kinase 1 OS=Arabidopsis thaliana GN=CERK1 PE=1 SV=1 165 285 3.0E-06
sp|P43298|TMK1_ARATH Receptor protein kinase TMK1 OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1 121 312 3.0E-06
sp|Q55GU0|Y9955_DICDI Probable serine/threonine-protein kinase DDB_G0267514 OS=Dictyostelium discoideum GN=DDB_G0267514 PE=3 SV=1 96 281 3.0E-06
sp|Q8MY86|FGFR1_DUGJA Fibroblast growth factor receptor 1 OS=Dugesia japonica GN=FGFR1 PE=2 SV=1 103 292 3.0E-06
sp|O22476|BRI1_ARATH Protein BRASSINOSTEROID INSENSITIVE 1 OS=Arabidopsis thaliana GN=BRI1 PE=1 SV=1 139 285 3.0E-06
sp|P32577|CSK_RAT Tyrosine-protein kinase CSK OS=Rattus norvegicus GN=Csk PE=1 SV=1 139 296 4.0E-06
sp|P41241|CSK_MOUSE Tyrosine-protein kinase CSK OS=Mus musculus GN=Csk PE=1 SV=2 139 296 4.0E-06
sp|P41240|CSK_HUMAN Tyrosine-protein kinase CSK OS=Homo sapiens GN=CSK PE=1 SV=1 139 296 5.0E-06
sp|P41239|CSK_CHICK Tyrosine-protein kinase CSK OS=Gallus gallus GN=CSK PE=2 SV=1 139 296 5.0E-06
sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 927 1227 5.0E-06
sp|Q55CZ1|GDT2_DICDI Probable serine/threonine-protein kinase gdt2 OS=Dictyostelium discoideum GN=gdt2 PE=2 SV=1 164 294 6.0E-06
sp|Q5F478|ANR44_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Gallus gallus GN=ANKRD44 PE=2 SV=1 742 1092 6.0E-06
sp|Q8RZV7|MSP1_ORYSJ Leucine-rich repeat receptor protein kinase MSP1 OS=Oryza sativa subsp. japonica GN=MSP1 PE=1 SV=1 4 304 6.0E-06
sp|Q8N8A2|ANR44_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit B OS=Homo sapiens GN=ANKRD44 PE=1 SV=3 742 1098 6.0E-06
sp|C0LGS2|Y4361_ARATH Probable LRR receptor-like serine/threonine-protein kinase At4g36180 OS=Arabidopsis thaliana GN=At4g36180 PE=2 SV=1 159 285 7.0E-06
sp|Q9ZRF9|RPK1_ARATH Probable LRR receptor-like serine/threonine-protein kinase RPK1 OS=Arabidopsis thaliana GN=RPK1 PE=1 SV=1 165 293 8.0E-06
sp|Q9FIJ6|ACCR4_ARATH Serine/threonine-protein kinase-like protein CCR4 OS=Arabidopsis thaliana GN=CCR4 PE=1 SV=1 138 299 8.0E-06
sp|Q0V7T5|Y1864_ARATH Probable receptor-like protein kinase At1g80640 OS=Arabidopsis thaliana GN=At1g80640 PE=2 SV=1 139 285 9.0E-06
sp|C0LGI2|Y1677_ARATH Probable LRR receptor-like serine/threonine-protein kinase At1g67720 OS=Arabidopsis thaliana GN=At1g67720 PE=2 SV=1 81 285 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0005515 protein binding Yes
GO:0004672 protein kinase activity Yes
GO:0006468 protein phosphorylation Yes
GO:0016310 phosphorylation No
GO:0071704 organic substance metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0006793 phosphorus metabolic process No
GO:0016740 transferase activity No
GO:0003674 molecular_function No
GO:0044237 cellular metabolic process No
GO:0008152 metabolic process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0140096 catalytic activity, acting on a protein No
GO:0044238 primary metabolic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:0000166 nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0003824 catalytic activity No
GO:0006807 nitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0036094 small molecule binding No
GO:0016301 kinase activity No
GO:0097159 organic cyclic compound binding No
GO:0097367 carbohydrate derivative binding No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0036211 protein modification process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0019538 protein metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0017076 purine nucleotide binding No
GO:0030554 adenyl nucleotide binding No
GO:0009987 cellular process No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 53 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1502
MDSSNSLTFRIRPEPEKKAGPTVTDQTLQTDDRQSRCPSLAAFLAICFSNEGERLGLHPVLTNTAPNLDDVSLRG
GSFDVRKVKSSSFPLQLADDLFRGRDFVVVKHPRPNSHDADRPEVFSEIAMELQVLRHSPIRSHANVIDLLAVMY
HDAGDAKRPVILPALVLEYAAFGSLKTFQEEGHGHSFEDKINIALDVARGIEALHACGIVHGDVKTSNMLVCKHA
IREFIVKVSDFGFSLVIGDLQLLGHTEIYCPPESYQGQLDPEHAKKVDIYCYGLLLHSVLKEGTAYYPQGPDAPV
GSSDDFQKMKLSGLMPSTLVLNLLITGPGREPYPLLLLSKILLYCLLPEPKQRIHAMSSIIFYLGLLESSCGGTS
GPQSDKSVSEKVTAMLETATEARKGAASGGASLLTSLTTVIRAMMGTLEGQILSPGSDQTRQFLAVVSTFTETVL
NNFITTAAKLEIPMFEVISTRLRSRAQKQLSQIAGEGPDSNQPSFSVARLCQLLLDCVGLFPETGALELTPGDSA
QTFSSPQLCLCQGYDLIPDFSLLHGVFQKMPWSVQKAAVQSLVQLHETTTDAVAKRKAALSLASVYANGIGVEFE
LSEASRLVLEAAKLGDEKAQTVYINAFCSDDPLQPHGVDEYSWRSWLSKSAEAGNDIALCRLRILDPAAISAISK
ARHQVEYAIANVNLAGVGGLCANITNNTSSDQLKAIFLSAVIEDNKCVVKHCLGLNQDLLVSRFDNGEHALLMAC
RLGSFQVAKALVSTRNANLGDEQGARPLHWLSRSSGEQHTIMAKLLIDNGADVDAIGPALHRSDNEQRVQRGRLR
WTPLHWAVAFDSPSAVHALLDLGCDPSLRAEPDRGTWDLSALELASSLCNIAALSALLTNEAVRSEVNRARPMVQ
GMAVFITPLFYVLGSRSRWERMRQHGMRSEQKTYETLSLLIENGAKTDRVLQSHDAKMPAVFATAYHSCCADVMA
SGLKLGFANEIDSTYGSLSSGGSALFLAITHRDRAMFEALVEAGASLSCRDKDGMTPLHRAAKENDDVFFTRALL
DAGVAVDPEPNSSLPSPFQVAVYCRNSNVAKLLFDSGADRDRIGPQHHRTILGDMLFMHTWNSLERVKFLLELPD
RPGGESDGFIAARLDDEKISVFHLAASYTSEATSQRPDITAIMVTQLLRKYNEKKHVNSTCGPFSMTALAVAVEN
GDYGVVRKLLEAGADPNVADKFGRAPLDLLYRRYCFPENLPTFDEVDHDDTLAIGRALQSINENTAEVLSLLTSY
GAEANTFRFPIWHQADPSYRNATWVLERLKEKKEKKPESKIGS
Coding >Ophio5|1502
ATGGACTCTTCTAACTCGCTCACGTTTCGCATCCGCCCAGAGCCGGAAAAGAAGGCCGGGCCGACTGTTACGGAT
CAGACACTCCAGACGGATGACCGGCAGTCGAGGTGTCCAAGCTTGGCTGCTTTCCTCGCGATATGCTTCTCCAAC
GAAGGCGAGCGGTTGGGCCTTCATCCAGTTCTCACAAACACGGCGCCAAACCTGGACGATGTCTCTCTTAGAGGC
GGCTCATTCGATGTTCGAAAAGTCAAGTCTTCCTCGTTTCCCCTTCAGCTGGCGGACGACCTGTTTCGGGGACGG
GATTTTGTCGTTGTCAAGCACCCTCGCCCCAATTCCCACGATGCAGACCGCCCGGAGGTCTTCTCCGAGATCGCC
ATGGAGCTTCAGGTCTTGCGGCATTCACCTATTCGGAGCCACGCCAACGTTATCGACCTGCTTGCTGTCATGTAT
CACGACGCCGGAGATGCCAAGCGGCCTGTTATCTTGCCCGCCCTTGTTCTCGAATACGCGGCTTTTGGCAGTCTC
AAGACATTCCAGGAGGAGGGACACGGCCACTCATTCGAGGACAAGATTAATATTGCGCTTGACGTAGCCAGGGGT
ATCGAGGCACTGCACGCTTGCGGCATTGTTCACGGTGACGTGAAGACGTCCAACATGCTCGTGTGCAAGCATGCC
ATCCGCGAATTCATTGTCAAGGTGTCCGACTTTGGCTTCTCCTTGGTTATTGGTGACCTGCAGCTGCTCGGGCAC
ACGGAGATTTACTGTCCCCCAGAGTCGTATCAAGGTCAACTGGATCCCGAGCACGCAAAGAAAGTGGACATTTAC
TGCTATGGTCTTCTCCTCCATTCTGTTCTCAAAGAAGGGACAGCATACTATCCTCAGGGCCCAGACGCTCCAGTA
GGAAGCTCCGACGACTTTCAGAAGATGAAATTGTCAGGGCTGATGCCGTCTACACTTGTGCTGAATCTCCTCATC
ACCGGACCCGGGCGAGAACCATACCCGCTACTTCTTCTTAGCAAGATTCTTCTCTATTGCCTACTGCCGGAGCCC
AAACAGCGGATCCACGCCATGTCAAGCATCATCTTTTATCTCGGCCTTCTCGAGAGCAGCTGCGGCGGCACAAGC
GGCCCTCAGTCTGACAAATCCGTGTCGGAAAAGGTCACTGCAATGCTAGAGACAGCGACTGAAGCCAGGAAGGGG
GCTGCCAGCGGCGGGGCTAGTCTACTAACCAGCCTAACGACTGTGATTCGGGCCATGATGGGAACTTTGGAGGGA
CAAATTTTGTCACCCGGCTCGGATCAGACCCGTCAATTCCTGGCTGTCGTCTCGACATTCACCGAAACGGTCCTC
AACAACTTTATCACTACGGCAGCCAAGTTAGAGATCCCAATGTTTGAAGTTATTTCCACACGGCTGCGGTCACGG
GCCCAGAAGCAGTTGTCACAAATAGCAGGCGAAGGTCCGGACTCTAATCAGCCGAGCTTTTCTGTGGCGCGGCTT
TGCCAATTACTGCTCGACTGCGTTGGATTGTTTCCAGAAACTGGTGCCTTGGAACTTACGCCAGGTGACTCGGCT
CAGACTTTCTCGTCGCCCCAGCTTTGTCTCTGTCAGGGTTACGATCTAATTCCAGATTTCTCCCTTCTTCATGGA
GTTTTTCAAAAAATGCCGTGGTCGGTACAGAAAGCCGCCGTGCAGAGCTTAGTGCAGCTGCATGAAACCACGACA
GATGCGGTCGCTAAGAGAAAGGCGGCTTTGAGTTTGGCCAGCGTTTATGCCAATGGCATCGGAGTCGAGTTCGAA
TTGAGTGAAGCTTCCAGGCTCGTCCTCGAAGCCGCCAAGCTCGGCGACGAAAAGGCACAAACGGTATACATTAAT
GCCTTCTGTTCAGACGATCCATTGCAGCCTCATGGTGTAGATGAGTACTCCTGGCGGTCATGGCTGAGTAAATCG
GCCGAGGCTGGCAACGACATCGCCCTCTGCAGGCTGCGCATCTTGGATCCAGCGGCAATCTCTGCCATCTCCAAG
GCCCGCCATCAAGTGGAATATGCTATCGCCAACGTCAACTTGGCAGGAGTCGGTGGTCTCTGTGCCAATATCACC
AATAACACCTCAAGCGACCAACTCAAAGCCATTTTCCTAAGTGCCGTCATTGAGGACAACAAATGTGTGGTCAAA
CATTGCCTTGGCCTGAACCAGGATCTGCTTGTCTCACGATTCGACAATGGCGAACACGCCCTTTTAATGGCATGC
AGACTGGGCAGTTTCCAGGTAGCGAAAGCTCTGGTCTCCACGCGCAACGCCAACCTCGGCGACGAACAGGGAGCT
CGTCCTCTGCACTGGCTAAGCCGCTCCTCAGGGGAACAACACACAATCATGGCGAAGCTTCTCATAGATAATGGA
GCTGATGTTGATGCCATTGGGCCTGCTCTCCACCGATCAGACAATGAGCAACGGGTTCAGCGTGGTCGTCTAAGA
TGGACTCCGCTCCACTGGGCTGTGGCTTTCGATAGCCCGTCTGCCGTACATGCGCTGCTTGATCTTGGGTGCGAT
CCATCGCTTCGAGCCGAGCCAGATAGAGGAACCTGGGACCTGAGTGCCCTGGAGCTCGCATCTAGTCTCTGCAAC
ATAGCGGCTCTCTCAGCCCTGCTAACCAACGAGGCAGTCCGTTCTGAGGTGAACAGAGCGCGACCAATGGTGCAG
GGTATGGCCGTTTTCATAACCCCCCTTTTCTACGTTCTAGGGTCAAGATCACGCTGGGAGCGCATGAGACAGCAC
GGCATGCGGTCTGAACAAAAGACTTACGAAACGCTCTCACTACTCATTGAGAATGGAGCCAAGACCGATCGAGTC
CTTCAGAGCCACGACGCAAAGATGCCGGCGGTCTTTGCCACAGCTTATCACTCGTGCTGCGCTGATGTCATGGCT
TCCGGTCTCAAGCTCGGCTTCGCCAACGAGATCGATTCCACTTACGGCTCGTTATCCAGCGGAGGTTCCGCATTG
TTTCTGGCCATTACTCACCGGGACCGCGCCATGTTCGAGGCCCTTGTCGAAGCTGGAGCGAGCCTCTCCTGCCGT
GACAAAGATGGTATGACGCCTCTGCACCGCGCAGCCAAGGAGAACGACGATGTGTTCTTTACCCGTGCCCTACTG
GATGCTGGGGTTGCCGTTGACCCGGAGCCGAACTCATCGCTGCCAAGTCCGTTCCAAGTCGCTGTCTACTGTCGT
AACAGTAACGTCGCCAAGTTGCTGTTCGACTCCGGCGCAGACCGCGATCGGATAGGACCCCAACACCACAGGACG
ATTCTCGGCGACATGCTCTTTATGCATACTTGGAACTCTCTCGAGCGTGTCAAGTTCCTGCTCGAACTTCCAGAC
CGACCTGGCGGTGAATCGGACGGCTTCATTGCCGCACGCTTAGACGACGAAAAGATTTCCGTCTTCCATCTTGCA
GCGTCATACACATCCGAAGCGACATCTCAGCGACCAGACATCACGGCCATCATGGTGACACAGCTGCTTCGAAAA
TATAACGAGAAGAAGCACGTGAACTCAACGTGCGGCCCGTTCTCAATGACGGCTCTCGCGGTTGCAGTCGAAAAT
GGGGATTATGGCGTGGTGCGAAAGCTGCTCGAGGCCGGGGCTGACCCAAACGTGGCCGACAAGTTTGGACGAGCG
CCGCTGGACCTGCTGTATCGGCGGTACTGCTTCCCGGAGAACTTGCCGACGTTCGATGAGGTCGATCATGATGAT
ACGCTGGCAATCGGACGGGCGTTGCAATCCATTAACGAGAACACCGCAGAAGTGTTGTCGCTTTTGACGAGCTAC
GGGGCAGAGGCCAACACGTTCCGCTTCCCGATCTGGCATCAAGCTGACCCTAGCTACCGAAATGCCACGTGGGTT
TTGGAGCGTTTGAAGGAGAAGAAGGAAAAGAAGCCAGAATCCAAGATCGGATCT
Transcript >Ophio5|1502
ATGGACTCTTCTAACTCGCTCACGTTTCGCATCCGCCCAGAGCCGGAAAAGAAGGCCGGGCCGACTGTTACGGAT
CAGACACTCCAGACGGATGACCGGCAGTCGAGGTGTCCAAGCTTGGCTGCTTTCCTCGCGATATGCTTCTCCAAC
GAAGGCGAGCGGTTGGGCCTTCATCCAGTTCTCACAAACACGGCGCCAAACCTGGACGATGTCTCTCTTAGAGGC
GGCTCATTCGATGTTCGAAAAGTCAAGTCTTCCTCGTTTCCCCTTCAGCTGGCGGACGACCTGTTTCGGGGACGG
GATTTTGTCGTTGTCAAGCACCCTCGCCCCAATTCCCACGATGCAGACCGCCCGGAGGTCTTCTCCGAGATCGCC
ATGGAGCTTCAGGTCTTGCGGCATTCACCTATTCGGAGCCACGCCAACGTTATCGACCTGCTTGCTGTCATGTAT
CACGACGCCGGAGATGCCAAGCGGCCTGTTATCTTGCCCGCCCTTGTTCTCGAATACGCGGCTTTTGGCAGTCTC
AAGACATTCCAGGAGGAGGGACACGGCCACTCATTCGAGGACAAGATTAATATTGCGCTTGACGTAGCCAGGGGT
ATCGAGGCACTGCACGCTTGCGGCATTGTTCACGGTGACGTGAAGACGTCCAACATGCTCGTGTGCAAGCATGCC
ATCCGCGAATTCATTGTCAAGGTGTCCGACTTTGGCTTCTCCTTGGTTATTGGTGACCTGCAGCTGCTCGGGCAC
ACGGAGATTTACTGTCCCCCAGAGTCGTATCAAGGTCAACTGGATCCCGAGCACGCAAAGAAAGTGGACATTTAC
TGCTATGGTCTTCTCCTCCATTCTGTTCTCAAAGAAGGGACAGCATACTATCCTCAGGGCCCAGACGCTCCAGTA
GGAAGCTCCGACGACTTTCAGAAGATGAAATTGTCAGGGCTGATGCCGTCTACACTTGTGCTGAATCTCCTCATC
ACCGGACCCGGGCGAGAACCATACCCGCTACTTCTTCTTAGCAAGATTCTTCTCTATTGCCTACTGCCGGAGCCC
AAACAGCGGATCCACGCCATGTCAAGCATCATCTTTTATCTCGGCCTTCTCGAGAGCAGCTGCGGCGGCACAAGC
GGCCCTCAGTCTGACAAATCCGTGTCGGAAAAGGTCACTGCAATGCTAGAGACAGCGACTGAAGCCAGGAAGGGG
GCTGCCAGCGGCGGGGCTAGTCTACTAACCAGCCTAACGACTGTGATTCGGGCCATGATGGGAACTTTGGAGGGA
CAAATTTTGTCACCCGGCTCGGATCAGACCCGTCAATTCCTGGCTGTCGTCTCGACATTCACCGAAACGGTCCTC
AACAACTTTATCACTACGGCAGCCAAGTTAGAGATCCCAATGTTTGAAGTTATTTCCACACGGCTGCGGTCACGG
GCCCAGAAGCAGTTGTCACAAATAGCAGGCGAAGGTCCGGACTCTAATCAGCCGAGCTTTTCTGTGGCGCGGCTT
TGCCAATTACTGCTCGACTGCGTTGGATTGTTTCCAGAAACTGGTGCCTTGGAACTTACGCCAGGTGACTCGGCT
CAGACTTTCTCGTCGCCCCAGCTTTGTCTCTGTCAGGGTTACGATCTAATTCCAGATTTCTCCCTTCTTCATGGA
GTTTTTCAAAAAATGCCGTGGTCGGTACAGAAAGCCGCCGTGCAGAGCTTAGTGCAGCTGCATGAAACCACGACA
GATGCGGTCGCTAAGAGAAAGGCGGCTTTGAGTTTGGCCAGCGTTTATGCCAATGGCATCGGAGTCGAGTTCGAA
TTGAGTGAAGCTTCCAGGCTCGTCCTCGAAGCCGCCAAGCTCGGCGACGAAAAGGCACAAACGGTATACATTAAT
GCCTTCTGTTCAGACGATCCATTGCAGCCTCATGGTGTAGATGAGTACTCCTGGCGGTCATGGCTGAGTAAATCG
GCCGAGGCTGGCAACGACATCGCCCTCTGCAGGCTGCGCATCTTGGATCCAGCGGCAATCTCTGCCATCTCCAAG
GCCCGCCATCAAGTGGAATATGCTATCGCCAACGTCAACTTGGCAGGAGTCGGTGGTCTCTGTGCCAATATCACC
AATAACACCTCAAGCGACCAACTCAAAGCCATTTTCCTAAGTGCCGTCATTGAGGACAACAAATGTGTGGTCAAA
CATTGCCTTGGCCTGAACCAGGATCTGCTTGTCTCACGATTCGACAATGGCGAACACGCCCTTTTAATGGCATGC
AGACTGGGCAGTTTCCAGGTAGCGAAAGCTCTGGTCTCCACGCGCAACGCCAACCTCGGCGACGAACAGGGAGCT
CGTCCTCTGCACTGGCTAAGCCGCTCCTCAGGGGAACAACACACAATCATGGCGAAGCTTCTCATAGATAATGGA
GCTGATGTTGATGCCATTGGGCCTGCTCTCCACCGATCAGACAATGAGCAACGGGTTCAGCGTGGTCGTCTAAGA
TGGACTCCGCTCCACTGGGCTGTGGCTTTCGATAGCCCGTCTGCCGTACATGCGCTGCTTGATCTTGGGTGCGAT
CCATCGCTTCGAGCCGAGCCAGATAGAGGAACCTGGGACCTGAGTGCCCTGGAGCTCGCATCTAGTCTCTGCAAC
ATAGCGGCTCTCTCAGCCCTGCTAACCAACGAGGCAGTCCGTTCTGAGGTGAACAGAGCGCGACCAATGGTGCAG
GGTATGGCCGTTTTCATAACCCCCCTTTTCTACGTTCTAGGGTCAAGATCACGCTGGGAGCGCATGAGACAGCAC
GGCATGCGGTCTGAACAAAAGACTTACGAAACGCTCTCACTACTCATTGAGAATGGAGCCAAGACCGATCGAGTC
CTTCAGAGCCACGACGCAAAGATGCCGGCGGTCTTTGCCACAGCTTATCACTCGTGCTGCGCTGATGTCATGGCT
TCCGGTCTCAAGCTCGGCTTCGCCAACGAGATCGATTCCACTTACGGCTCGTTATCCAGCGGAGGTTCCGCATTG
TTTCTGGCCATTACTCACCGGGACCGCGCCATGTTCGAGGCCCTTGTCGAAGCTGGAGCGAGCCTCTCCTGCCGT
GACAAAGATGGTATGACGCCTCTGCACCGCGCAGCCAAGGAGAACGACGATGTGTTCTTTACCCGTGCCCTACTG
GATGCTGGGGTTGCCGTTGACCCGGAGCCGAACTCATCGCTGCCAAGTCCGTTCCAAGTCGCTGTCTACTGTCGT
AACAGTAACGTCGCCAAGTTGCTGTTCGACTCCGGCGCAGACCGCGATCGGATAGGACCCCAACACCACAGGACG
ATTCTCGGCGACATGCTCTTTATGCATACTTGGAACTCTCTCGAGCGTGTCAAGTTCCTGCTCGAACTTCCAGAC
CGACCTGGCGGTGAATCGGACGGCTTCATTGCCGCACGCTTAGACGACGAAAAGATTTCCGTCTTCCATCTTGCA
GCGTCATACACATCCGAAGCGACATCTCAGCGACCAGACATCACGGCCATCATGGTGACACAGCTGCTTCGAAAA
TATAACGAGAAGAAGCACGTGAACTCAACGTGCGGCCCGTTCTCAATGACGGCTCTCGCGGTTGCAGTCGAAAAT
GGGGATTATGGCGTGGTGCGAAAGCTGCTCGAGGCCGGGGCTGACCCAAACGTGGCCGACAAGTTTGGACGAGCG
CCGCTGGACCTGCTGTATCGGCGGTACTGCTTCCCGGAGAACTTGCCGACGTTCGATGAGGTCGATCATGATGAT
ACGCTGGCAATCGGACGGGCGTTGCAATCCATTAACGAGAACACCGCAGAAGTGTTGTCGCTTTTGACGAGCTAC
GGGGCAGAGGCCAACACGTTCCGCTTCCCGATCTGGCATCAAGCTGACCCTAGCTACCGAAATGCCACGTGGGTT
TTGGAGCGTTTGAAGGAGAAGAAGGAAAAGAAGCCAGAATCCAAGATCGGATCTTGA
Gene >Ophio5|1502
ATGGACTCTTCTAACTCGCTCACGTTTCGCATCCGCCCAGAGCCGGAAAAGAAGGCCGGGCCGACTGTTACGGAT
CAGACACTCCAGACGGATGACCGGCAGTCGAGGTGTCCAAGCTTGGCTGCTTTCCTCGCGATATGCTTCTCCAAC
GAAGGCGAGCGGTTGGGCCTTCATCCAGTTCTCACAAACACGGCGCCAAACCTGGACGATGTCTCTCTTAGAGGC
GGCTCATTCGATGTTCGAAAAGTCAAGTCTTCCTCGTTTCCCCTTCAGCTGGCGGACGACCTGTTTCGGGGACGG
GATTTTGTCGTTGTCAAGCACCCTCGCCCCAATTCCCACGATGCAGACCGCCCGGAGGTCTTCTCCGAGATCGCC
ATGGAGCTTCAGGTCTTGCGGCATTCACCTATTCGGAGCCACGCCAACGTTATCGACCTGCTTGCTGTCATGTAT
CACGACGCCGGAGATGCCAAGCGGCCTGTTATCTTGCCCGCCCTTGTTCTCGAATACGCGGCTTTTGGCAGTCTC
AAGACATTCCAGGAGGAGGGACACGGCCACTCATTCGAGGACAAGATTAATATTGCGCTTGACGTAGCCAGGGGT
ATCGAGGCACTGCACGCTTGCGGCATTGTTCACGGTGACGTGAAGACGTCCAACATGCTCGTGTGCAAGCATGCC
ATCCGCGAATTCATTGTCAAGGTGTCCGACTTTGGCTTCTCCTTGGTTATTGGTGACCTGCAGCTGCTCGGGCAC
ACGGAGATTTACTGTCCCCCAGAGTCGTATCAAGGTCAACTGGATCCCGAGCACGCAAAGAAAGTGGACATTTAC
TGCTATGGTCTTCTCCTCCATTCTGTTCTCAAAGAAGGGACAGCATACTATCCTCAGGGCCCAGACGCTCCAGTA
GGAAGCTCCGACGACTTTCAGAAGATGAAATTGTCAGGGCTGATGCCGTCTACACTTGTGCTGAATCTCCTCATC
ACCGGACCCGGGCGAGAACCATACCCGCTACTTCTTCTTAGCAAGATTCTTCTCTATTGCCTACTGCCGGAGCCC
AAACAGCGGATCCACGCCATGTCAAGCATCATCTTTTATCTCGGCCTTCTCGAGAGCAGCTGCGGCGGCACAAGC
GGCCCTCAGTCTGACAAATCCGTGTCGGAAAAGGTCACTGCAATGCTAGAGACAGCGACTGAAGCCAGGAAGGGG
GCTGCCAGCGGCGGGGCTAGTCTACTAACCAGCCTAACGACTGTGATTCGGGCCATGATGGGAACTTTGGAGGGA
CAAATTTTGTCACCCGGCTCGGATCAGACCCGTCAATTCCTGGCTGTCGTCTCGACATTCACCGAAACGGTCCTC
AACAACTTTATCACTACGGCAGCCAAGTTAGAGATCCCAATGTTTGAAGTTATTTCCACACGGCTGCGGTCACGG
GCCCAGAAGCAGTTGTCACAAATAGCAGGCGAAGGTCCGGACTCTAATCAGCCGAGCTTTTCTGTGGCGCGGCTT
TGCCAATTACTGCTCGACTGCGTTGGATTGTTTCCAGAAACTGGTGCCTTGGAACTTACGCCAGGTGACTCGTAA
GTAACATGGTCGTTGCGAAAAGCTTTGTTTAAATTCATCATTGACGCGTTATTAGGGCTCAGACTTTCTCGTCGC
CCCAGCTTTGTCTCTGTCAGGGTTACGATCTAATTCCAGATGTGAGTATTTCCACGGCAGCTTTGTAGCCGGAGC
TTTTTGTCTCAACTTGGGTCCCAGTTCTCCCTTCTTCATGGAGTTTTTCAAAAAATGCCGTGGTCGGTACAGAAA
GCCGCCGTGCAGAGCTTAGTGCAGCTGCATGAAACCACGACAGATGCGGTCGCTAAGAGAAAGGCGGCTTTGAGT
TTGGCCAGCGTTTATGCCAATGGCATCGGAGTCGAGTTCGAATTGAGTGAAGCTTCCAGGCTCGTCCTCGAAGCC
GCCAAGCTCGGCGACGAAAAGGCACAAACGGTATACATTAATGCCTTCTGTTCAGACGATCCATTGCAGCCTCAT
GGTGTAGATGAGTACTCCTGGCGGTCATGGCTGAGTAAATCGGCCGAGGCTGGCAACGACATCGCCCTCTGCAGG
CTGCGCATCTTGGATCCAGCGGCAATCTCTGCCATCTCCAAGGCCCGCCATCAAGTGGAATATGCTATCGCCAAC
GTCAACTTGGCAGGAGTCGGTGGTCTCTGTGCCAATATCACCAATAACACCTCAAGCGACCAACTCAAAGCCATT
TTCCTAAGTGCCGTCATTGAGGACAACAAATGTGTGGTCAAACATTGCCTTGGCCTGAACCAGGATCTGCTTGTC
TCACGATTCGACAATGGCGAACACGCCCTTTTAATGGCATGCAGACTGGGCAGTTTCCAGGTAGCGAAAGCTCTG
GTCTCCACGCGCAACGCCAACCTCGGCGACGAACAGGGAGCTCGTCCTCTGCACTGGCTAAGCCGCTCCTCAGGG
GAACAACACACAATCATGGCGAAGCTTCTCATAGATAATGGAGCTGATGTTGATGCCATTGGGCCTGCTCTCCAC
CGATCAGACAATGAGCAACGGGTTCAGCGTGGTCGTCTAAGATGGACTCCGCTCCACTGGGCTGTGGCTTTCGAT
AGCCCGTCTGCCGTACATGCGCTGCTTGATCTTGGGTGCGATCCATCGCTTCGAGCCGAGCCAGATAGAGGAACC
TGGGACCTGAGTGCCCTGGAGCTCGCATCTAGTCTCTGCAACATAGCGGCTCTCTCAGCCCTGCTAACCAACGAG
GCAGTCCGTTCTGAGGTGAACAGAGCGCGACCAATGGTGCAGGGTATGGCCGTTTTCATAACCCCCCTTTTCTAC
GTTCTAGGGTCAAGATCACGCTGGGAGCGCATGAGACAGCACGGCATGCGGTCTGAACAAAAGACTTACGAAACG
CTCTCACTACTCATTGAGAATGGAGCCAAGACCGATCGAGTCCTTCAGAGCCACGACGCAAAGATGCCGGCGGTC
TTTGCCACAGCTTATCACTCGTGCTGCGCTGATGTCATGGCTTCCGGTCTCAAGCTCGGCTTCGCCAACGAGATC
GATTCCACTTACGGCTCGTTATCCAGCGGAGGTTCCGCATTGTTTCTGGCCATTACTCACCGGGACCGCGCCATG
TTCGAGGCCCTTGTCGAAGCTGGAGCGAGCCTCTCCTGCCGTGACAAAGATGGTATGACGCCTCTGCACCGCGCA
GCCAAGGAGAACGACGATGTGTTCTTTACCCGTGCCCTACTGGATGCTGGGGTTGCCGTTGACCCGGAGCCGAAC
TCATCGCTGCCAAGTCCGTTCCAAGTCGCTGTCTACTGTCGTAACAGTAACGTCGCCAAGTTGCTGTTCGACTCC
GGCGCAGACCGCGATCGGATAGGACCCCAACACCACAGGACGATTCTCGGCGACATGCTCTTTATGCATACTTGG
AACTCTCTCGAGCGTGTCAAGTTCCTGCTCGAACTTCCAGACCGACCTGGCGGTGAATCGGACGGCTTCATTGCC
GCACGCTTAGACGACGAAAAGATTTCCGTCTTCCATCTTGCAGCGTCATACACATCCGAAGCGACATCTCAGCGA
CCAGACATCACGGCCATCATGGTGACACAGCTGCTTCGAAAATATAACGAGAAGAAGCACGTGAACTCAACGTGC
GGCCCGTTCTCAATGACGGCTCTCGCGGTTGCAGTCGAAAATGGGGATTATGGCGTGGTGCGAAAGCTGCTCGAG
GCCGGGGCTGACCCAAACGTGGCCGACAAGTTTGGACGAGCGCCGCTGGACCTGCTGTATCGGCGGTACTGCTTC
CCGGAGAACTTGCCGACGTTCGATGAGGTCGATCATGATGATACGCTGGCAATCGGACGGGCGTTGCAATCCATT
AACGAGAACACCGCAGAAGTGTTGTCGCTTTTGACGAGCTACGGGGCAGAGGCCAACACGTTCCGCTTCCCGATC
TGGCATCAAGCTGACCCTAGCTACCGAAATGCCACGTGGGTTTTGGAGCGTTTGAAGGAGAAGAAGGAAAAGAAG
CCAGAATCCAAGATCGGATCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail