Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1493
Gene name
Locationscaffold_152:23922..26547
Strand+
Gene length (bp)2625
Transcript length (bp)2625
Coding sequence length (bp)2622
Protein length (aa) 874

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00924 MS_channel Mechanosensitive ion channel 6.9E-21 509 672

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74839|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1 150 738 2.0E-124
sp|O14050|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1 151 737 8.0E-74
sp|Q84M97|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=1 SV=1 432 712 2.0E-31
sp|Q9LYG9|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1 344 708 5.0E-31
sp|F4IME2|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2 297 752 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74839|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1 150 738 2.0E-124
sp|O14050|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1 151 737 8.0E-74
sp|Q84M97|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=1 SV=1 432 712 2.0E-31
sp|Q9LYG9|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1 344 708 5.0E-31
sp|F4IME2|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2 297 752 1.0E-22
sp|Q9LPG3|MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana GN=MSL4 PE=3 SV=1 419 729 2.0E-21
sp|Q9LH74|MSL5_ARATH Mechanosensitive ion channel protein 5 OS=Arabidopsis thaliana GN=MSL5 PE=2 SV=1 419 729 9.0E-21
sp|F4IME1|MSL7_ARATH Mechanosensitive ion channel protein 7 OS=Arabidopsis thaliana GN=MSL7 PE=3 SV=1 296 752 3.0E-20
sp|Q9SYM1|MSL6_ARATH Mechanosensitive ion channel protein 6 OS=Arabidopsis thaliana GN=MSL6 PE=1 SV=1 419 729 6.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 166 188 22
2 193 210 17
3 217 239 22
4 300 322 22
5 510 532 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 0.00 0.0 0.00
CcL In ants, during behavior modification 0.04 0.0 0.15
CcD In ants, recently dead 0.00 0.0 0.00

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 1.0 no
SC16a CcD 1.0 no
CcL CcD 1.0 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1493
MALPDRRSPMADKIDAQAQACRPAHSRGPSEERPPTLSLQTSRTIGPVDYFAEVESIASPATRRAHEVRMHDDLE
IRRVERCVTNTKTEGNRPPKVERIPDSGTDDCFKEKEREEHDEEEGGEEEEDDDDDEDDDDDGTSADKAKHGNAF
YKLRAVIHKLPRFFRYLVYLIPGAVLLLVPILLGTVNTEPDDRLLGGVGGVELMWFGIWLEIMWCSLWLSRLMTC
SLPYLLYGFAWMVASHTTKQWKEFGKRLEVPTATFLWFLAIVSSFKPTNDGHHAASPSPDGEDPGLEWVDIVNKV
FIALFTLAALNLLEKIAIQWIATSFHRRTYSTRIENNKADIRQLGQLYEHAKVKLNHNHTYLQMGGPRVAGSSTT
LQTLHENARQVLGKFGQVAGKVGNDLIGRKVNNNTTLKVVSELLRSTPASFTLARFIYRSLVRYDRETVFADDLK
AVFKTKEEVDAAFHVFDKDLNGDISRERFEAVCNEIHLEKKSIAASLRDLDSVIHKLNRVLLFIIVLIAAVVFIV
IMSGSATAGLASIGSTVLGLAWMLQATAQEFLQSIIFVFIKHPFDVGDRVTIYGSTGAKMQGDEYYVTEVSLLYT
EFKKMQGQIVQAPNSLLNTLFILNYRRSNGTSDPIRLEMRFGTPAHQIEELKERMLAFCLRNKRDFYPHVVTEML
KLEDVRSCSMNLVVKHKGNFQSESLRQARHNKLVTELMHQMIQVGIQGPYRAEPGGSQEFPMYWAGVQPPPFGHQ
HPPAPTAGDGSPAHVTPAGTARTASTIRRRRHVPIEDFTADPEDVYDHRRDEVAASRRLSIRKKERGFKLETEAQ
TSPATSEPVDTPGSQASRPSQARSRPSFWQRSASMFGKGSMQPSPPPPV
Coding >Ophio5|1493
ATGGCTCTCCCCGACAGACGCTCCCCCATGGCCGACAAAATAGATGCTCAAGCCCAAGCTTGTCGACCGGCGCAC
TCGCGCGGGCCATCGGAAGAGAGGCCCCCAACGCTCTCTCTCCAGACGTCGAGGACCATCGGCCCGGTCGATTAC
TTCGCCGAGGTCGAATCCATCGCGTCTCCAGCAACCCGACGTGCTCACGAGGTGCGCATGCACGATGATCTCGAG
ATCCGTCGCGTCGAGCGCTGTGTCACGAACACCAAGACGGAAGGCAATCGGCCTCCCAAGGTGGAGCGGATTCCA
GACTCGGGAACAGACGACTGCTTCAAGGAGAAGGAGCGTGAGGAGCATGACGAGGAGGAGGGGGGGGAGGAGGAG
GAGGATGATGATGATGATGAAGATGATGATGATGATGGTACCTCTGCGGATAAGGCGAAACATGGCAACGCCTTT
TACAAGCTGCGAGCTGTGATTCACAAGTTGCCTCGCTTCTTCCGCTACCTTGTCTATCTCATCCCGGGAGCGGTC
CTGCTTTTGGTTCCAATTCTCTTGGGGACCGTCAACACTGAGCCGGACGATAGGCTCCTCGGGGGGGTGGGCGGC
GTTGAGCTCATGTGGTTTGGCATATGGTTGGAGATTATGTGGTGCTCCTTGTGGCTGTCCCGTTTGATGACGTGC
TCCCTGCCGTATCTGCTCTACGGCTTCGCCTGGATGGTGGCCTCTCATACTACGAAGCAGTGGAAGGAGTTTGGG
AAAAGACTCGAGGTGCCGACGGCAACCTTTCTCTGGTTCTTGGCCATCGTCAGCTCCTTCAAGCCTACCAACGAC
GGACACCACGCCGCGTCTCCGAGCCCGGATGGCGAGGATCCGGGGCTAGAATGGGTCGACATCGTAAACAAAGTC
TTCATCGCCCTCTTCACTCTAGCAGCACTCAACCTGTTGGAAAAGATAGCGATCCAATGGATCGCCACCTCCTTC
CACCGTCGCACATACTCGACCAGAATCGAGAACAACAAGGCGGACATCCGGCAACTAGGCCAACTATACGAACAC
GCCAAAGTCAAGCTCAACCATAACCATACCTATCTGCAAATGGGCGGGCCTAGAGTTGCTGGCTCGTCGACTACG
TTGCAGACGCTGCATGAGAATGCTCGTCAGGTGCTGGGCAAGTTTGGTCAGGTTGCTGGCAAGGTGGGAAACGAC
CTTATCGGACGGAAGGTCAACAACAATACCACGCTCAAGGTTGTGTCCGAGTTGCTGCGCAGTACGCCGGCGTCG
TTTACGTTGGCTCGCTTCATTTATAGGAGCTTGGTGCGGTATGACCGGGAGACGGTCTTTGCGGATGATCTCAAG
GCTGTCTTCAAGACCAAAGAGGAGGTGGATGCTGCTTTTCATGTCTTTGACAAGGACCTCAACGGAGACATTTCG
CGCGAAAGGTTTGAAGCAGTGTGCAACGAGATTCATCTGGAGAAGAAGTCGATTGCGGCCTCGCTCAGGGATCTG
GACTCTGTCATTCACAAACTAAACCGCGTTTTGCTCTTCATCATCGTCCTCATTGCCGCCGTTGTCTTCATCGTC
ATCATGTCCGGCTCGGCTACGGCCGGTCTAGCCTCAATCGGGAGCACAGTTCTAGGTCTGGCGTGGATGCTGCAG
GCGACGGCTCAGGAGTTTCTGCAGTCCATCATCTTTGTCTTCATCAAGCATCCCTTCGACGTCGGTGATCGAGTC
ACCATCTACGGCTCGACAGGCGCCAAGATGCAAGGCGACGAGTATTACGTTACCGAGGTCTCTCTTCTCTACACC
GAGTTTAAGAAGATGCAGGGCCAGATTGTGCAGGCGCCCAACTCGTTACTCAACACGCTCTTTATCCTCAACTAT
CGCCGCTCCAACGGCACTTCGGATCCTATTCGGCTGGAGATGCGATTCGGAACGCCCGCCCACCAGATCGAGGAG
CTCAAGGAGCGTATGCTGGCGTTTTGTCTGCGGAATAAGCGCGACTTCTACCCTCATGTCGTCACCGAGATGCTC
AAGCTGGAAGACGTACGATCCTGTTCCATGAACCTGGTCGTCAAGCACAAGGGCAACTTCCAGAGCGAATCCCTC
CGTCAGGCTCGCCACAACAAGCTGGTGACCGAGCTCATGCATCAGATGATTCAAGTCGGTATCCAAGGTCCCTAT
CGCGCCGAACCGGGAGGCAGCCAGGAGTTCCCCATGTACTGGGCCGGCGTACAACCGCCTCCGTTCGGCCACCAG
CATCCTCCGGCTCCGACGGCAGGCGATGGCAGTCCAGCCCATGTCACGCCGGCCGGAACGGCGAGGACGGCTTCC
ACGATCCGTAGACGGAGACATGTACCCATTGAAGATTTCACTGCCGACCCGGAAGATGTCTACGACCATCGTCGT
GATGAGGTCGCTGCGTCGCGGAGGCTCTCCATTCGAAAGAAGGAGCGCGGCTTCAAGCTCGAAACGGAAGCCCAG
ACGTCTCCGGCTACGTCTGAGCCCGTTGATACACCGGGGTCACAGGCGTCAAGGCCATCGCAGGCGCGGTCGCGG
CCGAGCTTCTGGCAGAGGTCGGCGAGCATGTTTGGCAAGGGGAGCATGCAGCCGTCGCCGCCGCCACCGGTC
Transcript >Ophio5|1493
ATGGCTCTCCCCGACAGACGCTCCCCCATGGCCGACAAAATAGATGCTCAAGCCCAAGCTTGTCGACCGGCGCAC
TCGCGCGGGCCATCGGAAGAGAGGCCCCCAACGCTCTCTCTCCAGACGTCGAGGACCATCGGCCCGGTCGATTAC
TTCGCCGAGGTCGAATCCATCGCGTCTCCAGCAACCCGACGTGCTCACGAGGTGCGCATGCACGATGATCTCGAG
ATCCGTCGCGTCGAGCGCTGTGTCACGAACACCAAGACGGAAGGCAATCGGCCTCCCAAGGTGGAGCGGATTCCA
GACTCGGGAACAGACGACTGCTTCAAGGAGAAGGAGCGTGAGGAGCATGACGAGGAGGAGGGGGGGGAGGAGGAG
GAGGATGATGATGATGATGAAGATGATGATGATGATGGTACCTCTGCGGATAAGGCGAAACATGGCAACGCCTTT
TACAAGCTGCGAGCTGTGATTCACAAGTTGCCTCGCTTCTTCCGCTACCTTGTCTATCTCATCCCGGGAGCGGTC
CTGCTTTTGGTTCCAATTCTCTTGGGGACCGTCAACACTGAGCCGGACGATAGGCTCCTCGGGGGGGTGGGCGGC
GTTGAGCTCATGTGGTTTGGCATATGGTTGGAGATTATGTGGTGCTCCTTGTGGCTGTCCCGTTTGATGACGTGC
TCCCTGCCGTATCTGCTCTACGGCTTCGCCTGGATGGTGGCCTCTCATACTACGAAGCAGTGGAAGGAGTTTGGG
AAAAGACTCGAGGTGCCGACGGCAACCTTTCTCTGGTTCTTGGCCATCGTCAGCTCCTTCAAGCCTACCAACGAC
GGACACCACGCCGCGTCTCCGAGCCCGGATGGCGAGGATCCGGGGCTAGAATGGGTCGACATCGTAAACAAAGTC
TTCATCGCCCTCTTCACTCTAGCAGCACTCAACCTGTTGGAAAAGATAGCGATCCAATGGATCGCCACCTCCTTC
CACCGTCGCACATACTCGACCAGAATCGAGAACAACAAGGCGGACATCCGGCAACTAGGCCAACTATACGAACAC
GCCAAAGTCAAGCTCAACCATAACCATACCTATCTGCAAATGGGCGGGCCTAGAGTTGCTGGCTCGTCGACTACG
TTGCAGACGCTGCATGAGAATGCTCGTCAGGTGCTGGGCAAGTTTGGTCAGGTTGCTGGCAAGGTGGGAAACGAC
CTTATCGGACGGAAGGTCAACAACAATACCACGCTCAAGGTTGTGTCCGAGTTGCTGCGCAGTACGCCGGCGTCG
TTTACGTTGGCTCGCTTCATTTATAGGAGCTTGGTGCGGTATGACCGGGAGACGGTCTTTGCGGATGATCTCAAG
GCTGTCTTCAAGACCAAAGAGGAGGTGGATGCTGCTTTTCATGTCTTTGACAAGGACCTCAACGGAGACATTTCG
CGCGAAAGGTTTGAAGCAGTGTGCAACGAGATTCATCTGGAGAAGAAGTCGATTGCGGCCTCGCTCAGGGATCTG
GACTCTGTCATTCACAAACTAAACCGCGTTTTGCTCTTCATCATCGTCCTCATTGCCGCCGTTGTCTTCATCGTC
ATCATGTCCGGCTCGGCTACGGCCGGTCTAGCCTCAATCGGGAGCACAGTTCTAGGTCTGGCGTGGATGCTGCAG
GCGACGGCTCAGGAGTTTCTGCAGTCCATCATCTTTGTCTTCATCAAGCATCCCTTCGACGTCGGTGATCGAGTC
ACCATCTACGGCTCGACAGGCGCCAAGATGCAAGGCGACGAGTATTACGTTACCGAGGTCTCTCTTCTCTACACC
GAGTTTAAGAAGATGCAGGGCCAGATTGTGCAGGCGCCCAACTCGTTACTCAACACGCTCTTTATCCTCAACTAT
CGCCGCTCCAACGGCACTTCGGATCCTATTCGGCTGGAGATGCGATTCGGAACGCCCGCCCACCAGATCGAGGAG
CTCAAGGAGCGTATGCTGGCGTTTTGTCTGCGGAATAAGCGCGACTTCTACCCTCATGTCGTCACCGAGATGCTC
AAGCTGGAAGACGTACGATCCTGTTCCATGAACCTGGTCGTCAAGCACAAGGGCAACTTCCAGAGCGAATCCCTC
CGTCAGGCTCGCCACAACAAGCTGGTGACCGAGCTCATGCATCAGATGATTCAAGTCGGTATCCAAGGTCCCTAT
CGCGCCGAACCGGGAGGCAGCCAGGAGTTCCCCATGTACTGGGCCGGCGTACAACCGCCTCCGTTCGGCCACCAG
CATCCTCCGGCTCCGACGGCAGGCGATGGCAGTCCAGCCCATGTCACGCCGGCCGGAACGGCGAGGACGGCTTCC
ACGATCCGTAGACGGAGACATGTACCCATTGAAGATTTCACTGCCGACCCGGAAGATGTCTACGACCATCGTCGT
GATGAGGTCGCTGCGTCGCGGAGGCTCTCCATTCGAAAGAAGGAGCGCGGCTTCAAGCTCGAAACGGAAGCCCAG
ACGTCTCCGGCTACGTCTGAGCCCGTTGATACACCGGGGTCACAGGCGTCAAGGCCATCGCAGGCGCGGTCGCGG
CCGAGCTTCTGGCAGAGGTCGGCGAGCATGTTTGGCAAGGGGAGCATGCAGCCGTCGCCGCCGCCACCGGTCTGA
Gene >Ophio5|1493
ATGGCTCTCCCCGACAGACGCTCCCCCATGGCCGACAAAATAGATGCTCAAGCCCAAGCTTGTCGACCGGCGCAC
TCGCGCGGGCCATCGGAAGAGAGGCCCCCAACGCTCTCTCTCCAGACGTCGAGGACCATCGGCCCGGTCGATTAC
TTCGCCGAGGTCGAATCCATCGCGTCTCCAGCAACCCGACGTGCTCACGAGGTGCGCATGCACGATGATCTCGAG
ATCCGTCGCGTCGAGCGCTGTGTCACGAACACCAAGACGGAAGGCAATCGGCCTCCCAAGGTGGAGCGGATTCCA
GACTCGGGAACAGACGACTGCTTCAAGGAGAAGGAGCGTGAGGAGCATGACGAGGAGGAGGGGGGGGAGGAGGAG
GAGGATGATGATGATGATGAAGATGATGATGATGATGGTACCTCTGCGGATAAGGCGAAACATGGCAACGCCTTT
TACAAGCTGCGAGCTGTGATTCACAAGTTGCCTCGCTTCTTCCGCTACCTTGTCTATCTCATCCCGGGAGCGGTC
CTGCTTTTGGTTCCAATTCTCTTGGGGACCGTCAACACTGAGCCGGACGATAGGCTCCTCGGGGGGGTGGGCGGC
GTTGAGCTCATGTGGTTTGGCATATGGTTGGAGATTATGTGGTGCTCCTTGTGGCTGTCCCGTTTGATGACGTGC
TCCCTGCCGTATCTGCTCTACGGCTTCGCCTGGATGGTGGCCTCTCATACTACGAAGCAGTGGAAGGAGTTTGGG
AAAAGACTCGAGGTGCCGACGGCAACCTTTCTCTGGTTCTTGGCCATCGTCAGCTCCTTCAAGCCTACCAACGAC
GGACACCACGCCGCGTCTCCGAGCCCGGATGGCGAGGATCCGGGGCTAGAATGGGTCGACATCGTAAACAAAGTC
TTCATCGCCCTCTTCACTCTAGCAGCACTCAACCTGTTGGAAAAGATAGCGATCCAATGGATCGCCACCTCCTTC
CACCGTCGCACATACTCGACCAGAATCGAGAACAACAAGGCGGACATCCGGCAACTAGGCCAACTATACGAACAC
GCCAAAGTCAAGCTCAACCATAACCATACCTATCTGCAAATGGGCGGGCCTAGAGTTGCTGGCTCGTCGACTACG
TTGCAGACGCTGCATGAGAATGCTCGTCAGGTGCTGGGCAAGTTTGGTCAGGTTGCTGGCAAGGTGGGAAACGAC
CTTATCGGACGGAAGGTCAACAACAATACCACGCTCAAGGTTGTGTCCGAGTTGCTGCGCAGTACGCCGGCGTCG
TTTACGTTGGCTCGCTTCATTTATAGGAGCTTGGTGCGGTATGACCGGGAGACGGTCTTTGCGGATGATCTCAAG
GCTGTCTTCAAGACCAAAGAGGAGGTGGATGCTGCTTTTCATGTCTTTGACAAGGACCTCAACGGAGACATTTCG
CGCGAAAGGTTTGAAGCAGTGTGCAACGAGATTCATCTGGAGAAGAAGTCGATTGCGGCCTCGCTCAGGGATCTG
GACTCTGTCATTCACAAACTAAACCGCGTTTTGCTCTTCATCATCGTCCTCATTGCCGCCGTTGTCTTCATCGTC
ATCATGTCCGGCTCGGCTACGGCCGGTCTAGCCTCAATCGGGAGCACAGTTCTAGGTCTGGCGTGGATGCTGCAG
GCGACGGCTCAGGAGTTTCTGCAGTCCATCATCTTTGTCTTCATCAAGCATCCCTTCGACGTCGGTGATCGAGTC
ACCATCTACGGCTCGACAGGCGCCAAGATGCAAGGCGACGAGTATTACGTTACCGAGGTCTCTCTTCTCTACACC
GAGTTTAAGAAGATGCAGGGCCAGATTGTGCAGGCGCCCAACTCGTTACTCAACACGCTCTTTATCCTCAACTAT
CGCCGCTCCAACGGCACTTCGGATCCTATTCGGCTGGAGATGCGATTCGGAACGCCCGCCCACCAGATCGAGGAG
CTCAAGGAGCGTATGCTGGCGTTTTGTCTGCGGAATAAGCGCGACTTCTACCCTCATGTCGTCACCGAGATGCTC
AAGCTGGAAGACGTACGATCCTGTTCCATGAACCTGGTCGTCAAGCACAAGGGCAACTTCCAGAGCGAATCCCTC
CGTCAGGCTCGCCACAACAAGCTGGTGACCGAGCTCATGCATCAGATGATTCAAGTCGGTATCCAAGGTCCCTAT
CGCGCCGAACCGGGAGGCAGCCAGGAGTTCCCCATGTACTGGGCCGGCGTACAACCGCCTCCGTTCGGCCACCAG
CATCCTCCGGCTCCGACGGCAGGCGATGGCAGTCCAGCCCATGTCACGCCGGCCGGAACGGCGAGGACGGCTTCC
ACGATCCGTAGACGGAGACATGTACCCATTGAAGATTTCACTGCCGACCCGGAAGATGTCTACGACCATCGTCGT
GATGAGGTCGCTGCGTCGCGGAGGCTCTCCATTCGAAAGAAGGAGCGCGGCTTCAAGCTCGAAACGGAAGCCCAG
ACGTCTCCGGCTACGTCTGAGCCCGTTGATACACCGGGGTCACAGGCGTCAAGGCCATCGCAGGCGCGGTCGCGG
CCGAGCTTCTGGCAGAGGTCGGCGAGCATGTTTGGCAAGGGGAGCATGCAGCCGTCGCCGCCGCCACCGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail