Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1493
Gene name
Locationscaffold_152:23922..26547
Strand+
Gene length (bp)2625
Transcript length (bp)2625
Coding sequence length (bp)2622
Protein length (aa) 874

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00924 MS_channel Mechanosensitive ion channel 6.9E-21 509 672

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74839|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1 150 738 2.0E-124
sp|O14050|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1 151 737 8.0E-74
sp|Q84M97|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=1 SV=1 432 712 2.0E-31
sp|Q9LYG9|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1 344 708 5.0E-31
sp|F4IME2|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2 297 752 1.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74839|YC1B_SCHPO Uncharacterized MscS family protein C1183.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1183.11 PE=1 SV=1 150 738 2.0E-124
sp|O14050|YEYH_SCHPO Uncharacterized MscS family protein C2C4.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2C4.17c PE=3 SV=1 151 737 8.0E-74
sp|Q84M97|MSL9_ARATH Mechanosensitive ion channel protein 9 OS=Arabidopsis thaliana GN=MSL9 PE=1 SV=1 432 712 2.0E-31
sp|Q9LYG9|MSL10_ARATH Mechanosensitive ion channel protein 10 OS=Arabidopsis thaliana GN=MSL10 PE=1 SV=1 344 708 5.0E-31
sp|F4IME2|MSL8_ARATH Mechanosensitive ion channel protein 8 OS=Arabidopsis thaliana GN=MSL8 PE=2 SV=2 297 752 1.0E-22
sp|Q9LPG3|MSL4_ARATH Mechanosensitive ion channel protein 4 OS=Arabidopsis thaliana GN=MSL4 PE=3 SV=1 419 729 2.0E-21
sp|Q9LH74|MSL5_ARATH Mechanosensitive ion channel protein 5 OS=Arabidopsis thaliana GN=MSL5 PE=2 SV=1 419 729 9.0E-21
sp|F4IME1|MSL7_ARATH Mechanosensitive ion channel protein 7 OS=Arabidopsis thaliana GN=MSL7 PE=3 SV=1 296 752 3.0E-20
sp|Q9SYM1|MSL6_ARATH Mechanosensitive ion channel protein 6 OS=Arabidopsis thaliana GN=MSL6 PE=1 SV=1 419 729 6.0E-19
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 27 0.45

Transmembrane Domains

Domain # Start End Length
1 166 188 22
2 193 210 17
3 217 239 22
4 300 322 22
5 510 532 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1493
MALPDRRSPMADKIDAQAQACRPAHSRGPSEERPPTLSLQTSRTIGPVDYFAEVESIASPATRRAHEVRMHDDLE
IRRVERCVTNTKTEGNRPPKVERIPDSGTDDCFKEKEREEHDEEEGGEEEEDDDDDEDDDDDGTSADKAKHGNAF
YKLRAVIHKLPRFFRYLVYLIPGAVLLLVPILLGTVNTEPDDRLLGGVGGVELMWFGIWLEIMWCSLWLSRLMTC
SLPYLLYGFAWMVASHTTKQWKEFGKRLEVPTATFLWFLAIVSSFKPTNDGHHAASPSPDGEDPGLEWVDIVNKV
FIALFTLAALNLLEKIAIQWIATSFHRRTYSTRIENNKADIRQLGQLYEHAKVKLNHNHTYLQMGGPRVAGSSTT
LQTLHENARQVLGKFGQVAGKVGNDLIGRKVNNNTTLKVVSELLRSTPASFTLARFIYRSLVRYDRETVFADDLK
AVFKTKEEVDAAFHVFDKDLNGDISRERFEAVCNEIHLEKKSIAASLRDLDSVIHKLNRVLLFIIVLIAAVVFIV
IMSGSATAGLASIGSTVLGLAWMLQATAQEFLQSIIFVFIKHPFDVGDRVTIYGSTGAKMQGDEYYVTEVSLLYT
EFKKMQGQIVQAPNSLLNTLFILNYRRSNGTSDPIRLEMRFGTPAHQIEELKERMLAFCLRNKRDFYPHVVTEML
KLEDVRSCSMNLVVKHKGNFQSESLRQARHNKLVTELMHQMIQVGIQGPYRAEPGGSQEFPMYWAGVQPPPFGHQ
HPPAPTAGDGSPAHVTPAGTARTASTIRRRRHVPIEDFTADPEDVYDHRRDEVAASRRLSIRKKERGFKLETEAQ
TSPATSEPVDTPGSQASRPSQARSRPSFWQRSASMFGKGSMQPSPPPPV
Coding >Ophio5|1493
ATGGCTCTCCCCGACAGACGCTCCCCCATGGCCGACAAAATAGATGCTCAAGCCCAAGCTTGTCGACCGGCGCAC
TCGCGCGGGCCATCGGAAGAGAGGCCCCCAACGCTCTCTCTCCAGACGTCGAGGACCATCGGCCCGGTCGATTAC
TTCGCCGAGGTCGAATCCATCGCGTCTCCAGCAACCCGACGTGCTCACGAGGTGCGCATGCACGATGATCTCGAG
ATCCGTCGCGTCGAGCGCTGTGTCACGAACACCAAGACGGAAGGCAATCGGCCTCCCAAGGTGGAGCGGATTCCA
GACTCGGGAACAGACGACTGCTTCAAGGAGAAGGAGCGTGAGGAGCATGACGAGGAGGAGGGGGGGGAGGAGGAG
GAGGATGATGATGATGATGAAGATGATGATGATGATGGTACCTCTGCGGATAAGGCGAAACATGGCAACGCCTTT
TACAAGCTGCGAGCTGTGATTCACAAGTTGCCTCGCTTCTTCCGCTACCTTGTCTATCTCATCCCGGGAGCGGTC
CTGCTTTTGGTTCCAATTCTCTTGGGGACCGTCAACACTGAGCCGGACGATAGGCTCCTCGGGGGGGTGGGCGGC
GTTGAGCTCATGTGGTTTGGCATATGGTTGGAGATTATGTGGTGCTCCTTGTGGCTGTCCCGTTTGATGACGTGC
TCCCTGCCGTATCTGCTCTACGGCTTCGCCTGGATGGTGGCCTCTCATACTACGAAGCAGTGGAAGGAGTTTGGG
AAAAGACTCGAGGTGCCGACGGCAACCTTTCTCTGGTTCTTGGCCATCGTCAGCTCCTTCAAGCCTACCAACGAC
GGACACCACGCCGCGTCTCCGAGCCCGGATGGCGAGGATCCGGGGCTAGAATGGGTCGACATCGTAAACAAAGTC
TTCATCGCCCTCTTCACTCTAGCAGCACTCAACCTGTTGGAAAAGATAGCGATCCAATGGATCGCCACCTCCTTC
CACCGTCGCACATACTCGACCAGAATCGAGAACAACAAGGCGGACATCCGGCAACTAGGCCAACTATACGAACAC
GCCAAAGTCAAGCTCAACCATAACCATACCTATCTGCAAATGGGCGGGCCTAGAGTTGCTGGCTCGTCGACTACG
TTGCAGACGCTGCATGAGAATGCTCGTCAGGTGCTGGGCAAGTTTGGTCAGGTTGCTGGCAAGGTGGGAAACGAC
CTTATCGGACGGAAGGTCAACAACAATACCACGCTCAAGGTTGTGTCCGAGTTGCTGCGCAGTACGCCGGCGTCG
TTTACGTTGGCTCGCTTCATTTATAGGAGCTTGGTGCGGTATGACCGGGAGACGGTCTTTGCGGATGATCTCAAG
GCTGTCTTCAAGACCAAAGAGGAGGTGGATGCTGCTTTTCATGTCTTTGACAAGGACCTCAACGGAGACATTTCG
CGCGAAAGGTTTGAAGCAGTGTGCAACGAGATTCATCTGGAGAAGAAGTCGATTGCGGCCTCGCTCAGGGATCTG
GACTCTGTCATTCACAAACTAAACCGCGTTTTGCTCTTCATCATCGTCCTCATTGCCGCCGTTGTCTTCATCGTC
ATCATGTCCGGCTCGGCTACGGCCGGTCTAGCCTCAATCGGGAGCACAGTTCTAGGTCTGGCGTGGATGCTGCAG
GCGACGGCTCAGGAGTTTCTGCAGTCCATCATCTTTGTCTTCATCAAGCATCCCTTCGACGTCGGTGATCGAGTC
ACCATCTACGGCTCGACAGGCGCCAAGATGCAAGGCGACGAGTATTACGTTACCGAGGTCTCTCTTCTCTACACC
GAGTTTAAGAAGATGCAGGGCCAGATTGTGCAGGCGCCCAACTCGTTACTCAACACGCTCTTTATCCTCAACTAT
CGCCGCTCCAACGGCACTTCGGATCCTATTCGGCTGGAGATGCGATTCGGAACGCCCGCCCACCAGATCGAGGAG
CTCAAGGAGCGTATGCTGGCGTTTTGTCTGCGGAATAAGCGCGACTTCTACCCTCATGTCGTCACCGAGATGCTC
AAGCTGGAAGACGTACGATCCTGTTCCATGAACCTGGTCGTCAAGCACAAGGGCAACTTCCAGAGCGAATCCCTC
CGTCAGGCTCGCCACAACAAGCTGGTGACCGAGCTCATGCATCAGATGATTCAAGTCGGTATCCAAGGTCCCTAT
CGCGCCGAACCGGGAGGCAGCCAGGAGTTCCCCATGTACTGGGCCGGCGTACAACCGCCTCCGTTCGGCCACCAG
CATCCTCCGGCTCCGACGGCAGGCGATGGCAGTCCAGCCCATGTCACGCCGGCCGGAACGGCGAGGACGGCTTCC
ACGATCCGTAGACGGAGACATGTACCCATTGAAGATTTCACTGCCGACCCGGAAGATGTCTACGACCATCGTCGT
GATGAGGTCGCTGCGTCGCGGAGGCTCTCCATTCGAAAGAAGGAGCGCGGCTTCAAGCTCGAAACGGAAGCCCAG
ACGTCTCCGGCTACGTCTGAGCCCGTTGATACACCGGGGTCACAGGCGTCAAGGCCATCGCAGGCGCGGTCGCGG
CCGAGCTTCTGGCAGAGGTCGGCGAGCATGTTTGGCAAGGGGAGCATGCAGCCGTCGCCGCCGCCACCGGTC
Transcript >Ophio5|1493
ATGGCTCTCCCCGACAGACGCTCCCCCATGGCCGACAAAATAGATGCTCAAGCCCAAGCTTGTCGACCGGCGCAC
TCGCGCGGGCCATCGGAAGAGAGGCCCCCAACGCTCTCTCTCCAGACGTCGAGGACCATCGGCCCGGTCGATTAC
TTCGCCGAGGTCGAATCCATCGCGTCTCCAGCAACCCGACGTGCTCACGAGGTGCGCATGCACGATGATCTCGAG
ATCCGTCGCGTCGAGCGCTGTGTCACGAACACCAAGACGGAAGGCAATCGGCCTCCCAAGGTGGAGCGGATTCCA
GACTCGGGAACAGACGACTGCTTCAAGGAGAAGGAGCGTGAGGAGCATGACGAGGAGGAGGGGGGGGAGGAGGAG
GAGGATGATGATGATGATGAAGATGATGATGATGATGGTACCTCTGCGGATAAGGCGAAACATGGCAACGCCTTT
TACAAGCTGCGAGCTGTGATTCACAAGTTGCCTCGCTTCTTCCGCTACCTTGTCTATCTCATCCCGGGAGCGGTC
CTGCTTTTGGTTCCAATTCTCTTGGGGACCGTCAACACTGAGCCGGACGATAGGCTCCTCGGGGGGGTGGGCGGC
GTTGAGCTCATGTGGTTTGGCATATGGTTGGAGATTATGTGGTGCTCCTTGTGGCTGTCCCGTTTGATGACGTGC
TCCCTGCCGTATCTGCTCTACGGCTTCGCCTGGATGGTGGCCTCTCATACTACGAAGCAGTGGAAGGAGTTTGGG
AAAAGACTCGAGGTGCCGACGGCAACCTTTCTCTGGTTCTTGGCCATCGTCAGCTCCTTCAAGCCTACCAACGAC
GGACACCACGCCGCGTCTCCGAGCCCGGATGGCGAGGATCCGGGGCTAGAATGGGTCGACATCGTAAACAAAGTC
TTCATCGCCCTCTTCACTCTAGCAGCACTCAACCTGTTGGAAAAGATAGCGATCCAATGGATCGCCACCTCCTTC
CACCGTCGCACATACTCGACCAGAATCGAGAACAACAAGGCGGACATCCGGCAACTAGGCCAACTATACGAACAC
GCCAAAGTCAAGCTCAACCATAACCATACCTATCTGCAAATGGGCGGGCCTAGAGTTGCTGGCTCGTCGACTACG
TTGCAGACGCTGCATGAGAATGCTCGTCAGGTGCTGGGCAAGTTTGGTCAGGTTGCTGGCAAGGTGGGAAACGAC
CTTATCGGACGGAAGGTCAACAACAATACCACGCTCAAGGTTGTGTCCGAGTTGCTGCGCAGTACGCCGGCGTCG
TTTACGTTGGCTCGCTTCATTTATAGGAGCTTGGTGCGGTATGACCGGGAGACGGTCTTTGCGGATGATCTCAAG
GCTGTCTTCAAGACCAAAGAGGAGGTGGATGCTGCTTTTCATGTCTTTGACAAGGACCTCAACGGAGACATTTCG
CGCGAAAGGTTTGAAGCAGTGTGCAACGAGATTCATCTGGAGAAGAAGTCGATTGCGGCCTCGCTCAGGGATCTG
GACTCTGTCATTCACAAACTAAACCGCGTTTTGCTCTTCATCATCGTCCTCATTGCCGCCGTTGTCTTCATCGTC
ATCATGTCCGGCTCGGCTACGGCCGGTCTAGCCTCAATCGGGAGCACAGTTCTAGGTCTGGCGTGGATGCTGCAG
GCGACGGCTCAGGAGTTTCTGCAGTCCATCATCTTTGTCTTCATCAAGCATCCCTTCGACGTCGGTGATCGAGTC
ACCATCTACGGCTCGACAGGCGCCAAGATGCAAGGCGACGAGTATTACGTTACCGAGGTCTCTCTTCTCTACACC
GAGTTTAAGAAGATGCAGGGCCAGATTGTGCAGGCGCCCAACTCGTTACTCAACACGCTCTTTATCCTCAACTAT
CGCCGCTCCAACGGCACTTCGGATCCTATTCGGCTGGAGATGCGATTCGGAACGCCCGCCCACCAGATCGAGGAG
CTCAAGGAGCGTATGCTGGCGTTTTGTCTGCGGAATAAGCGCGACTTCTACCCTCATGTCGTCACCGAGATGCTC
AAGCTGGAAGACGTACGATCCTGTTCCATGAACCTGGTCGTCAAGCACAAGGGCAACTTCCAGAGCGAATCCCTC
CGTCAGGCTCGCCACAACAAGCTGGTGACCGAGCTCATGCATCAGATGATTCAAGTCGGTATCCAAGGTCCCTAT
CGCGCCGAACCGGGAGGCAGCCAGGAGTTCCCCATGTACTGGGCCGGCGTACAACCGCCTCCGTTCGGCCACCAG
CATCCTCCGGCTCCGACGGCAGGCGATGGCAGTCCAGCCCATGTCACGCCGGCCGGAACGGCGAGGACGGCTTCC
ACGATCCGTAGACGGAGACATGTACCCATTGAAGATTTCACTGCCGACCCGGAAGATGTCTACGACCATCGTCGT
GATGAGGTCGCTGCGTCGCGGAGGCTCTCCATTCGAAAGAAGGAGCGCGGCTTCAAGCTCGAAACGGAAGCCCAG
ACGTCTCCGGCTACGTCTGAGCCCGTTGATACACCGGGGTCACAGGCGTCAAGGCCATCGCAGGCGCGGTCGCGG
CCGAGCTTCTGGCAGAGGTCGGCGAGCATGTTTGGCAAGGGGAGCATGCAGCCGTCGCCGCCGCCACCGGTCTGA
Gene >Ophio5|1493
ATGGCTCTCCCCGACAGACGCTCCCCCATGGCCGACAAAATAGATGCTCAAGCCCAAGCTTGTCGACCGGCGCAC
TCGCGCGGGCCATCGGAAGAGAGGCCCCCAACGCTCTCTCTCCAGACGTCGAGGACCATCGGCCCGGTCGATTAC
TTCGCCGAGGTCGAATCCATCGCGTCTCCAGCAACCCGACGTGCTCACGAGGTGCGCATGCACGATGATCTCGAG
ATCCGTCGCGTCGAGCGCTGTGTCACGAACACCAAGACGGAAGGCAATCGGCCTCCCAAGGTGGAGCGGATTCCA
GACTCGGGAACAGACGACTGCTTCAAGGAGAAGGAGCGTGAGGAGCATGACGAGGAGGAGGGGGGGGAGGAGGAG
GAGGATGATGATGATGATGAAGATGATGATGATGATGGTACCTCTGCGGATAAGGCGAAACATGGCAACGCCTTT
TACAAGCTGCGAGCTGTGATTCACAAGTTGCCTCGCTTCTTCCGCTACCTTGTCTATCTCATCCCGGGAGCGGTC
CTGCTTTTGGTTCCAATTCTCTTGGGGACCGTCAACACTGAGCCGGACGATAGGCTCCTCGGGGGGGTGGGCGGC
GTTGAGCTCATGTGGTTTGGCATATGGTTGGAGATTATGTGGTGCTCCTTGTGGCTGTCCCGTTTGATGACGTGC
TCCCTGCCGTATCTGCTCTACGGCTTCGCCTGGATGGTGGCCTCTCATACTACGAAGCAGTGGAAGGAGTTTGGG
AAAAGACTCGAGGTGCCGACGGCAACCTTTCTCTGGTTCTTGGCCATCGTCAGCTCCTTCAAGCCTACCAACGAC
GGACACCACGCCGCGTCTCCGAGCCCGGATGGCGAGGATCCGGGGCTAGAATGGGTCGACATCGTAAACAAAGTC
TTCATCGCCCTCTTCACTCTAGCAGCACTCAACCTGTTGGAAAAGATAGCGATCCAATGGATCGCCACCTCCTTC
CACCGTCGCACATACTCGACCAGAATCGAGAACAACAAGGCGGACATCCGGCAACTAGGCCAACTATACGAACAC
GCCAAAGTCAAGCTCAACCATAACCATACCTATCTGCAAATGGGCGGGCCTAGAGTTGCTGGCTCGTCGACTACG
TTGCAGACGCTGCATGAGAATGCTCGTCAGGTGCTGGGCAAGTTTGGTCAGGTTGCTGGCAAGGTGGGAAACGAC
CTTATCGGACGGAAGGTCAACAACAATACCACGCTCAAGGTTGTGTCCGAGTTGCTGCGCAGTACGCCGGCGTCG
TTTACGTTGGCTCGCTTCATTTATAGGAGCTTGGTGCGGTATGACCGGGAGACGGTCTTTGCGGATGATCTCAAG
GCTGTCTTCAAGACCAAAGAGGAGGTGGATGCTGCTTTTCATGTCTTTGACAAGGACCTCAACGGAGACATTTCG
CGCGAAAGGTTTGAAGCAGTGTGCAACGAGATTCATCTGGAGAAGAAGTCGATTGCGGCCTCGCTCAGGGATCTG
GACTCTGTCATTCACAAACTAAACCGCGTTTTGCTCTTCATCATCGTCCTCATTGCCGCCGTTGTCTTCATCGTC
ATCATGTCCGGCTCGGCTACGGCCGGTCTAGCCTCAATCGGGAGCACAGTTCTAGGTCTGGCGTGGATGCTGCAG
GCGACGGCTCAGGAGTTTCTGCAGTCCATCATCTTTGTCTTCATCAAGCATCCCTTCGACGTCGGTGATCGAGTC
ACCATCTACGGCTCGACAGGCGCCAAGATGCAAGGCGACGAGTATTACGTTACCGAGGTCTCTCTTCTCTACACC
GAGTTTAAGAAGATGCAGGGCCAGATTGTGCAGGCGCCCAACTCGTTACTCAACACGCTCTTTATCCTCAACTAT
CGCCGCTCCAACGGCACTTCGGATCCTATTCGGCTGGAGATGCGATTCGGAACGCCCGCCCACCAGATCGAGGAG
CTCAAGGAGCGTATGCTGGCGTTTTGTCTGCGGAATAAGCGCGACTTCTACCCTCATGTCGTCACCGAGATGCTC
AAGCTGGAAGACGTACGATCCTGTTCCATGAACCTGGTCGTCAAGCACAAGGGCAACTTCCAGAGCGAATCCCTC
CGTCAGGCTCGCCACAACAAGCTGGTGACCGAGCTCATGCATCAGATGATTCAAGTCGGTATCCAAGGTCCCTAT
CGCGCCGAACCGGGAGGCAGCCAGGAGTTCCCCATGTACTGGGCCGGCGTACAACCGCCTCCGTTCGGCCACCAG
CATCCTCCGGCTCCGACGGCAGGCGATGGCAGTCCAGCCCATGTCACGCCGGCCGGAACGGCGAGGACGGCTTCC
ACGATCCGTAGACGGAGACATGTACCCATTGAAGATTTCACTGCCGACCCGGAAGATGTCTACGACCATCGTCGT
GATGAGGTCGCTGCGTCGCGGAGGCTCTCCATTCGAAAGAAGGAGCGCGGCTTCAAGCTCGAAACGGAAGCCCAG
ACGTCTCCGGCTACGTCTGAGCCCGTTGATACACCGGGGTCACAGGCGTCAAGGCCATCGCAGGCGCGGTCGCGG
CCGAGCTTCTGGCAGAGGTCGGCGAGCATGTTTGGCAAGGGGAGCATGCAGCCGTCGCCGCCGCCACCGGTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail