Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1491
Gene name
Locationscaffold_152:18056..18966
Strand+
Gene length (bp)910
Transcript length (bp)627
Coding sequence length (bp)624
Protein length (aa) 208

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20174 DUF6540 Family of unknown function (DUF6540) 8.8E-07 56 173

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6534 0.5148 0.5016 0.07 0.153 0.0322 0.0969 0.1305 0.0841 0.076

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup842
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6267
Ophiocordyceps camponoti-floridani Ophcf2|05332
Ophiocordyceps camponoti-rufipedis Ophun1|5834
Ophiocordyceps kimflemingae Ophio5|1491 (this protein)
Ophiocordyceps kimflemingae Ophio5|4909
Ophiocordyceps subramaniannii Hirsu2|4527
Ophiocordyceps subramaniannii Hirsu2|8822

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1491
MWDRSNHLSSNMDSAVARPVGKLPAGAHNFKRMAKQIAVALYHRDHFSRGKARQTFGYEAYHWNIMIMPQVSKGR
DCHAYEATDASEIDLVTFRMKNPTMDWWLRSKENIDPSLSAKLLGRIVIGEVKEGVSSAQLRDFFAKIRLPVKNT
HPQQSCVTWAVDAIRALQEQGWVLEFDPEQFKDWALVYADERMKGSASREPGVTYYRF
Coding >Ophio5|1491
ATGTGGGACAGGTCCAATCATCTTTCATCGAATATGGATTCGGCGGTTGCAAGGCCCGTTGGGAAGCTGCCGGCT
GGTGCCCATAACTTTAAAAGAATGGCAAAACAGATTGCCGTGGCCCTCTACCATCGAGACCATTTTTCTCGGGGC
AAGGCGCGGCAAACATTCGGCTACGAAGCTTACCACTGGAACATAATGATTATGCCCCAGGTAAGCAAAGGACGA
GACTGTCACGCCTACGAAGCCACCGACGCATCAGAAATCGACCTGGTAACATTTCGAATGAAAAACCCCACCATG
GACTGGTGGCTCCGATCAAAGGAGAATATCGATCCTAGTCTCAGTGCTAAGCTTCTCGGACGTATCGTTATAGGG
GAAGTAAAAGAGGGTGTATCAAGTGCTCAGCTTCGCGACTTTTTCGCAAAGATTCGTCTACCGGTGAAGAATACG
CATCCGCAGCAGAGCTGTGTGACGTGGGCTGTTGATGCTATCCGTGCTCTTCAGGAACAAGGATGGGTATTGGAG
TTTGATCCTGAGCAGTTTAAGGATTGGGCGCTCGTTTATGCGGATGAGAGGATGAAAGGGTCGGCTTCGAGGGAG
CCGGGGGTGACGTACTACCGTTTT
Transcript >Ophio5|1491
ATGTGGGACAGGTCCAATCATCTTTCATCGAATATGGATTCGGCGGTTGCAAGGCCCGTTGGGAAGCTGCCGGCT
GGTGCCCATAACTTTAAAAGAATGGCAAAACAGATTGCCGTGGCCCTCTACCATCGAGACCATTTTTCTCGGGGC
AAGGCGCGGCAAACATTCGGCTACGAAGCTTACCACTGGAACATAATGATTATGCCCCAGGTAAGCAAAGGACGA
GACTGTCACGCCTACGAAGCCACCGACGCATCAGAAATCGACCTGGTAACATTTCGAATGAAAAACCCCACCATG
GACTGGTGGCTCCGATCAAAGGAGAATATCGATCCTAGTCTCAGTGCTAAGCTTCTCGGACGTATCGTTATAGGG
GAAGTAAAAGAGGGTGTATCAAGTGCTCAGCTTCGCGACTTTTTCGCAAAGATTCGTCTACCGGTGAAGAATACG
CATCCGCAGCAGAGCTGTGTGACGTGGGCTGTTGATGCTATCCGTGCTCTTCAGGAACAAGGATGGGTATTGGAG
TTTGATCCTGAGCAGTTTAAGGATTGGGCGCTCGTTTATGCGGATGAGAGGATGAAAGGGTCGGCTTCGAGGGAG
CCGGGGGTGACGTACTACCGTTTTTAA
Gene >Ophio5|1491
ATGTGGGACAGGTCCAATCATCTTTCATCGAATATGGATTCGGCGGTTGCAAGGCCCGTTGGGAAGCTGCCGGCT
GGTGGTAAATGAAGGATTGAGATGTGTCAGACTGACACATCAGTTGATAAAGCTTATGATAGCATTCTGTTGTTG
CCTTTAGCAACACGTGCATGCACACTACAGTCCTTAGAAAAGCATTGGCCATGTGGCATGATATAAAGAACCGTA
TTGAATGGCTAGTTGCCGTCATTGACATCCGCTTTTCTTATTTTTCAGTGCCCGAGTCTTTCTTTGATTCATATA
CGCGGTTTAGCCCATAAGTAATAAAACCGGGAACTGCCTATTCTTTACCTTTTAATGACACCGCGTTAGCTTTAA
AAGAATGGCAAAACAGATTGCCGTGGCCCTCTACCATCGAGACCATTTTTCTCGGGGCAAGGCGCGGCAAACATT
CGGCTACGAAGCTTACCACTGGAACATAATGATTATGCCCCAGGTAAGCAAAGGACGAGACTGTCACGCCTACGA
AGCCACCGACGCATCAGAAATCGACCTGGTAACATTTCGAATGAAAAACCCCACCATGGACTGGTGGCTCCGATC
AAAGGAGAATATCGATCCTAGTCTCAGTGCTAAGCTTCTCGGACGTATCGTTATAGGGGAAGTAAAAGAGGGTGT
ATCAAGTGCTCAGCTTCGCGACTTTTTCGCAAAGATTCGTCTACCGGTGAAGAATACGCATCCGCAGCAGAGCTG
TGTGACGTGGGCTGTTGATGCTATCCGTGCTCTTCAGGAACAAGGATGGGTATTGGAGTTTGATCCTGAGCAGTT
TAAGGATTGGGCGCTCGTTTATGCGGATGAGAGGATGAAAGGGTCGGCTTCGAGGGAGCCGGGGGTGACGTACTA
CCGTTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail