Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1478
Gene name
Locationscaffold_151:26438..29636
Strand-
Gene length (bp)3198
Transcript length (bp)2361
Coding sequence length (bp)2358
Protein length (aa) 786

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10056 DUF2293 Uncharacterized conserved protein (DUF2293) 3.0E-29 271 358

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.4635 0.8291 0.2185 0.0484 0.2069 0.1293 0.111 0.0553 0.0591 0.0418

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup922
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4515
Ophiocordyceps australis map64 (Brazil) OphauB2|2427
Ophiocordyceps camponoti-floridani Ophcf2|01546
Ophiocordyceps camponoti-rufipedis Ophun1|2864
Ophiocordyceps kimflemingae Ophio5|1478 (this protein)
Ophiocordyceps subramaniannii Hirsu2|6381

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1478
MGCSQFILRVMKENTGKLGVLIPIKKRDKKQTKLWPLSRSPSLLTLTRRRNCSGALRERPKRATRDPFTICLSLF
FYSDPASLPFDTYLGHQTNIMGTNKRRQPGTVVGGFKEHFKRASRPNQEEDVSVPQDLVIKRPLPVVKSRHRSYF
EFVENTDKKKKLEYKETFNTNPPHGFQFVPVGNPELTNGCKELSRENGLMIYIVSTSNSAPARSLATQMSRVGYH
FHAAIVREARSTLSHLPDLVVSSPDGAPEPIPESQELYHSQVDAILRDLFPRIPHTDRQIIIRHSFTRGVLFHGE
KPVGLTEDVPLCRRVQLAVLAHVRHNHTTYDDLLKRLPWMVTRKAIQPACLDVLVKWRGDEESGRDQLDEILREV
VIISDSEDDDSDVESTDGTSVEEVVSSNSASRCQSFLRAERHHRANQLTSSRAEGAAVNATGVDRKARRGFDRYR
RAWEEAVQRNGDSLLDAAGSVHDHDASTSHALHDASGNAPTANGYVPRSLQAYGQPSGRSTMIPNGPYHEAELLA
REQAPMDPGSRHPWHPLGSATQDMLVRSVEPAPSEAGQQSFITGPFPRPGTRLEHHSVHQHQSMQYYSGRSPSPA
QAPDNSSPAWRIMHRTDGLLATSSAQTSAFRRDQCGVATPVFAMPSLPARVHEAPASVAQPTAERIVVNTARPGS
RSNPIVMEDRGGFFERVGPAESPKPRQLHGQFLRSPAQGEAPMPRRALTGSEPVTHRVLAVTDIISRLEKAMPFT
LNRRRSAGSHTTRSCETTFSHSLLHRVTGSFADTSR
Coding >Ophio5|1478
ATGGGCTGTTCACAATTTATTCTGCGGGTGATGAAAGAAAATACTGGTAAACTCGGAGTTTTGATTCCGATAAAG
AAAAGGGACAAAAAACAAACAAAGCTGTGGCCTTTGTCGCGTTCGCCTTCACTGCTCACCCTGACCCGCCGCCGC
AACTGTTCGGGAGCACTTCGTGAGAGGCCAAAACGCGCTACGCGTGATCCCTTCACCATCTGTCTATCTCTGTTT
TTCTATTCCGATCCCGCGTCTTTACCTTTCGACACCTATCTCGGACATCAAACGAATATCATGGGCACCAACAAG
CGGAGGCAACCCGGCACCGTCGTCGGTGGTTTCAAGGAGCATTTCAAGCGCGCCAGCCGGCCAAACCAAGAGGAA
GATGTTTCTGTGCCTCAGGACCTTGTGATAAAGCGGCCATTGCCCGTCGTCAAGTCGAGGCATCGCAGCTATTTT
GAATTTGTCGAAAACACGGACAAGAAGAAGAAACTCGAGTACAAGGAGACGTTCAACACCAACCCACCGCATGGC
TTCCAGTTTGTTCCCGTCGGCAACCCAGAATTGACCAATGGATGCAAGGAGCTGTCCCGCGAAAACGGCTTGATG
ATCTACATTGTCTCGACTTCCAATTCAGCCCCCGCGCGTAGCCTCGCCACCCAGATGAGTAGGGTCGGCTACCAT
TTTCACGCAGCCATCGTGCGGGAAGCCAGGTCTACCTTGAGTCATCTGCCGGACTTGGTGGTAAGCTCCCCGGAC
GGGGCTCCTGAGCCCATTCCGGAGTCACAGGAGCTCTATCATTCTCAAGTCGATGCCATCTTGCGCGATCTTTTC
CCGCGTATACCTCACACAGATCGGCAAATCATCATTCGCCATTCTTTCACACGCGGCGTCTTGTTCCACGGTGAA
AAACCTGTTGGACTCACCGAAGATGTCCCGCTCTGCCGCAGGGTTCAGCTGGCAGTCCTGGCCCATGTCAGGCAC
AATCATACCACGTATGACGACCTGCTGAAGCGCCTGCCGTGGATGGTCACTCGGAAGGCAATTCAACCTGCCTGT
CTGGACGTCCTCGTGAAGTGGCGTGGAGACGAGGAATCGGGCCGGGACCAGCTCGACGAGATCCTGCGCGAGGTC
GTCATCATTTCCGACTCCGAGGACGATGATTCCGATGTCGAGTCCACTGATGGCACATCTGTCGAGGAAGTCGTC
TCTTCAAATTCTGCATCGCGTTGCCAGTCTTTTTTGCGTGCTGAGAGGCATCATCGAGCAAATCAGCTGACATCT
TCCAGGGCCGAAGGCGCAGCCGTCAATGCCACTGGCGTGGATCGAAAAGCCCGTCGCGGCTTTGATCGTTACCGC
CGAGCCTGGGAAGAAGCCGTTCAGCGCAACGGTGACTCGCTACTTGACGCCGCGGGATCCGTCCATGACCATGAT
GCTTCCACATCGCATGCTCTCCATGATGCTTCTGGTAATGCCCCAACGGCCAATGGCTATGTCCCGCGGAGCCTT
CAAGCGTACGGGCAGCCGTCAGGCCGCAGTACCATGATTCCCAATGGGCCTTATCACGAGGCTGAGCTTCTCGCT
CGCGAACAAGCTCCCATGGACCCTGGCTCGCGTCATCCATGGCACCCATTGGGCTCTGCAACCCAGGACATGTTG
GTACGCTCAGTCGAGCCTGCACCCTCGGAAGCCGGGCAGCAATCCTTCATCACGGGCCCTTTCCCCCGTCCTGGC
ACGAGACTGGAGCATCATTCGGTTCACCAGCACCAGAGCATGCAGTACTACTCTGGTCGATCTCCGTCTCCGGCG
CAAGCGCCCGACAACTCCTCGCCGGCTTGGCGGATCATGCACCGTACGGACGGGCTTCTGGCAACGAGCTCAGCC
CAAACGTCCGCTTTTCGTCGTGACCAATGCGGAGTTGCGACGCCCGTCTTTGCCATGCCCAGCCTCCCAGCTCGA
GTTCATGAAGCTCCCGCCTCCGTGGCTCAGCCGACGGCTGAACGCATCGTCGTGAACACGGCCCGACCCGGTTCT
CGGTCGAACCCCATCGTCATGGAAGACCGTGGCGGCTTCTTCGAAAGGGTTGGGCCAGCCGAATCTCCGAAGCCG
CGGCAGCTCCATGGCCAGTTTCTCAGGTCCCCAGCGCAGGGGGAGGCTCCAATGCCGCGTCGAGCTCTCACCGGA
TCCGAGCCCGTTACCCACCGCGTCCTGGCCGTGACGGATATCATCAGCCGTCTGGAGAAGGCCATGCCCTTCACT
CTCAATCGGCGTCGTTCCGCAGGCAGCCATACAACTAGGAGTTGCGAAACGACCTTCAGCCATTCTTTACTGCAC
CGGGTCACTGGCAGCTTCGCAGACACCAGCCGT
Transcript >Ophio5|1478
ATGGGCTGTTCACAATTTATTCTGCGGGTGATGAAAGAAAATACTGGTAAACTCGGAGTTTTGATTCCGATAAAG
AAAAGGGACAAAAAACAAACAAAGCTGTGGCCTTTGTCGCGTTCGCCTTCACTGCTCACCCTGACCCGCCGCCGC
AACTGTTCGGGAGCACTTCGTGAGAGGCCAAAACGCGCTACGCGTGATCCCTTCACCATCTGTCTATCTCTGTTT
TTCTATTCCGATCCCGCGTCTTTACCTTTCGACACCTATCTCGGACATCAAACGAATATCATGGGCACCAACAAG
CGGAGGCAACCCGGCACCGTCGTCGGTGGTTTCAAGGAGCATTTCAAGCGCGCCAGCCGGCCAAACCAAGAGGAA
GATGTTTCTGTGCCTCAGGACCTTGTGATAAAGCGGCCATTGCCCGTCGTCAAGTCGAGGCATCGCAGCTATTTT
GAATTTGTCGAAAACACGGACAAGAAGAAGAAACTCGAGTACAAGGAGACGTTCAACACCAACCCACCGCATGGC
TTCCAGTTTGTTCCCGTCGGCAACCCAGAATTGACCAATGGATGCAAGGAGCTGTCCCGCGAAAACGGCTTGATG
ATCTACATTGTCTCGACTTCCAATTCAGCCCCCGCGCGTAGCCTCGCCACCCAGATGAGTAGGGTCGGCTACCAT
TTTCACGCAGCCATCGTGCGGGAAGCCAGGTCTACCTTGAGTCATCTGCCGGACTTGGTGGTAAGCTCCCCGGAC
GGGGCTCCTGAGCCCATTCCGGAGTCACAGGAGCTCTATCATTCTCAAGTCGATGCCATCTTGCGCGATCTTTTC
CCGCGTATACCTCACACAGATCGGCAAATCATCATTCGCCATTCTTTCACACGCGGCGTCTTGTTCCACGGTGAA
AAACCTGTTGGACTCACCGAAGATGTCCCGCTCTGCCGCAGGGTTCAGCTGGCAGTCCTGGCCCATGTCAGGCAC
AATCATACCACGTATGACGACCTGCTGAAGCGCCTGCCGTGGATGGTCACTCGGAAGGCAATTCAACCTGCCTGT
CTGGACGTCCTCGTGAAGTGGCGTGGAGACGAGGAATCGGGCCGGGACCAGCTCGACGAGATCCTGCGCGAGGTC
GTCATCATTTCCGACTCCGAGGACGATGATTCCGATGTCGAGTCCACTGATGGCACATCTGTCGAGGAAGTCGTC
TCTTCAAATTCTGCATCGCGTTGCCAGTCTTTTTTGCGTGCTGAGAGGCATCATCGAGCAAATCAGCTGACATCT
TCCAGGGCCGAAGGCGCAGCCGTCAATGCCACTGGCGTGGATCGAAAAGCCCGTCGCGGCTTTGATCGTTACCGC
CGAGCCTGGGAAGAAGCCGTTCAGCGCAACGGTGACTCGCTACTTGACGCCGCGGGATCCGTCCATGACCATGAT
GCTTCCACATCGCATGCTCTCCATGATGCTTCTGGTAATGCCCCAACGGCCAATGGCTATGTCCCGCGGAGCCTT
CAAGCGTACGGGCAGCCGTCAGGCCGCAGTACCATGATTCCCAATGGGCCTTATCACGAGGCTGAGCTTCTCGCT
CGCGAACAAGCTCCCATGGACCCTGGCTCGCGTCATCCATGGCACCCATTGGGCTCTGCAACCCAGGACATGTTG
GTACGCTCAGTCGAGCCTGCACCCTCGGAAGCCGGGCAGCAATCCTTCATCACGGGCCCTTTCCCCCGTCCTGGC
ACGAGACTGGAGCATCATTCGGTTCACCAGCACCAGAGCATGCAGTACTACTCTGGTCGATCTCCGTCTCCGGCG
CAAGCGCCCGACAACTCCTCGCCGGCTTGGCGGATCATGCACCGTACGGACGGGCTTCTGGCAACGAGCTCAGCC
CAAACGTCCGCTTTTCGTCGTGACCAATGCGGAGTTGCGACGCCCGTCTTTGCCATGCCCAGCCTCCCAGCTCGA
GTTCATGAAGCTCCCGCCTCCGTGGCTCAGCCGACGGCTGAACGCATCGTCGTGAACACGGCCCGACCCGGTTCT
CGGTCGAACCCCATCGTCATGGAAGACCGTGGCGGCTTCTTCGAAAGGGTTGGGCCAGCCGAATCTCCGAAGCCG
CGGCAGCTCCATGGCCAGTTTCTCAGGTCCCCAGCGCAGGGGGAGGCTCCAATGCCGCGTCGAGCTCTCACCGGA
TCCGAGCCCGTTACCCACCGCGTCCTGGCCGTGACGGATATCATCAGCCGTCTGGAGAAGGCCATGCCCTTCACT
CTCAATCGGCGTCGTTCCGCAGGCAGCCATACAACTAGGAGTTGCGAAACGACCTTCAGCCATTCTTTACTGCAC
CGGGTCACTGGCAGCTTCGCAGACACCAGCCGTTGA
Gene >Ophio5|1478
ATGGGCTGTTCACAATTTATTCTGCGGGTGATGAAAGAAAATACTGGTAAACTCGGAGTTTTGATTCCGATAAAG
AAAAGGGACAAAAAACAAACAAAGGTACGGTCATTCACTTCTCTTCACCCAGCCTCAGGCACTGTTTGCGCCACA
TGCGGGATGCCAATCCGCTCCTCTCATCGCGGGCCATGCTTGTAGACGTCTTTCCACATAGTTTTCAATGCTTCT
ACTGCTCTGTCTACCTCGCTCCGCTTGGGAAGTTCGTCCACCGTCGTGCTCTAGTGAGCTTCGGCTGCTTCTGGA
GGTAGACTGGACGCAAAGTCACCTGACTCGACCCAGCGCTTTCATAAGCTGGCCCGTTGCCCTTCAAGCGACGTT
TTTCCGCCCCTCATCCGTATCCGTCAGCCCCTCAACGCGTGACAGCTGCCCGAAAACATCCACTGCAGCCTCATA
TCGTCGTAAACTTGCCAGTCTGAGCAGCCGACACTTCTCATCATCTTCTTCTGTCCCCCTTTCCCCCCCCCCTCC
TCTTGGCTAACAGGCTTGCACAATTTCCAGCTGTGGCCTTTGTCGCGTTCGCCTTCACTGCTCACCCTGACCCGC
CGCCGCAACTGTTCGGGAGCACTTCGTGAGAGGCCAAAACGCGCTACGCGTGATCCCTTCACCATCTGTCTATCT
CTGTTTTTCTATTCCGATCCCGCGTCTTTACCTTTCGACACCTATCTCGGACATCAAGTAGCTTTGTTCCCCCCC
TACCTACCCTCTAAACCCCCCCTTCACGCTCACAACTTGGTCATGTTTCGCCCTCTTTCCTGAGCCTCTCAGACG
AATATCATGGGCACCAACAAGCGGAGGCAACCCGGCACCGTCGTCGGTGGTTTCAAGGAGCATTTCAAGCGCGCC
AGCCGGCCAAACCAAGAGGAAGATGTTTCTGTGCCTCAGGACCTTGTGATAAAGCGGCCATTGCCCGTCGTCAAG
TCGAGGCATCGCAGCTATTTTGAATTTGTCGAAAACACGGACAAGAAGAAGAAACTCGAGTACAAGGTAAGCATG
GTCTGTTCCTCCCGTCCCATGCTCTTAAGCTGACCCGCCGCAGGAGACGTTCAACACCAACCCACCGCATGGCTT
CCAGTTTGTTCCCGTCGGCAACCCAGAATTGACCAATGGATGCAAGGAGCTGTCCCGCGAAAACGGCTTGATGAT
CTACATTGTCTCGGTACGGACCAAGGAGGCAGATCGCCAACTTAAACACGCTGCTCACTCTTGTCAGACTTCCAA
TTCAGCCCCCGCGCGTAGCCTCGCCACCCAGATGAGTAGGGTCGGCTACCATTTTCACGCAGCCATCGTGCGGGA
AGCCAGGTCTACCTTGAGTCATCTGCCGGACTTGGTGGTAAGCTCCCCGGACGGGGCTCCTGAGCCCATTCCGGA
GTCACAGGAGCTCTATCATTCTCAAGTCGATGCCATCTTGCGCGATCTTTTCCCGCGTATACCTCACACAGATCG
GCAAATCATCATTCGCCATTCTTTCACACGCGTCTGTACACCGTCAAGCCCCGTCCTTGTCATTAAAACTAAGAG
TCTTGACCAGGGCGTCTTGTTCCACGGTGAAAAACCTGTTGGACTCACCGAAGATGTCCCGCTCTGCCGCAGGGT
TCAGCTGGCAGTCCTGGCCCATGTCAGGCACAATCATACCACGTATGACGACCTGCTGAAGCGCCTGCCGTGGAT
GGTCACTCGGAAGGCAATTCAACCTGCCTGTCTGGACGTCCTCGTGAAGTGGCGTGGAGACGAGGAATCGGGCCG
GGACCAGCTCGACGAGATCCTGCGCGAGGTCGTCATCATTTCCGACTCCGAGGACGATGATTCCGATGTCGAGTC
CACTGATGGCACATCTGTCGAGGAAGTCGTCTCTTCAAATTCTGCATCGCGTTGCCAGTCTTTTTTGCGTGCTGA
GAGGCATCATCGAGCAAATCAGCTGACATCTTCCAGGGCCGAAGGCGCAGCCGTCAATGCCACTGGCGTGGATCG
AAAAGCCCGTCGCGGCTTTGATCGTTACCGCCGAGCCTGGGAAGAAGCCGTTCAGCGCAACGGTGACTCGCTACT
TGACGCCGCGGGATCCGTCCATGACCATGATGCTTCCACATCGCATGCTCTCCATGATGCTTCTGGTAATGCCCC
AACGGCCAATGGCTATGTCCCGCGGAGCCTTCAAGCGTACGGGCAGCCGTCAGGCCGCAGTACCATGATTCCCAA
TGGGCCTTATCACGAGGCTGAGCTTCTCGCTCGCGAACAAGCTCCCATGGACCCTGGCTCGCGTCATCCATGGCA
CCCATTGGGCTCTGCAACCCAGGACATGTTGGTACGCTCAGTCGAGCCTGCACCCTCGGAAGCCGGGCAGCAATC
CTTCATCACGGGCCCTTTCCCCCGTCCTGGCACGAGACTGGAGCATCATTCGGTTCACCAGCACCAGAGCATGCA
GTACTACTCTGGTCGATCTCCGTCTCCGGCGCAAGCGCCCGACAACTCCTCGCCGGCTTGGCGGATCATGCACCG
TACGGACGGGCTTCTGGCAACGAGCTCAGCCCAAACGTCCGCTTTTCGTCGTGACCAATGCGGAGTTGCGACGCC
CGTCTTTGCCATGCCCAGCCTCCCAGCTCGAGTTCATGAAGCTCCCGCCTCCGTGGCTCAGCCGACGGCTGAACG
CATCGTCGTGAACACGGCCCGACCCGGTTCTCGGTCGAACCCCATCGTCATGGAAGACCGTGGCGGCTTCTTCGA
AAGGGTTGGGCCAGCCGAATCTCCGAAGCCGCGGCAGCTCCATGGCCAGTTTCTCAGGTCCCCAGCGCAGGGGGA
GGCTCCAATGCCGCGTCGAGCTCTCACCGGATCCGAGCCCGTTACCCACCGTAGTTCTGGCATGGCCGTCCCCTT
TTCTTCCCATGCAAGTTCGTGGGGCCTCGATAGGCGTCCTGGCCGTGACGGATATCATCAGCCGTCTGGAGAAGG
CCATGCCCTTCACTCTCAATCGGCGTCGTTCCGCAGGCAGCCATACAACTAGGAGTGAGTTGGCGGGCGCTTCAA
GGGTTCGTGTTTGACGTTGCGAGGACCGACTCCTTACAATATCTCCCTTCAGGTTGCGAAACGACCTTCAGCCAT
TCTTTACTGCACCGGGTCACTGGCAGCTTCGCAGACACCAGCCGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail