Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1465
Gene name
Locationscaffold_1509:116..1048
Strand-
Gene length (bp)932
Transcript length (bp)738
Coding sequence length (bp)735
Protein length (aa) 245

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9AJU1|ELMM2_STROV 8-demethyl-8-(2-methoxy-alpha-L-rhamnosyl)-tetracenomycin-C 3'-O-methyltransferase OS=Streptomyces olivaceus GN=elmMII PE=1 SV=1 55 240 6.0E-24
sp|Q9AJU2|ELMM1_STROV 8-demethyl-8-alpha-L-rhamnosyl tetracenomycin-C 2'-O-methyltransferase OS=Streptomyces olivaceus GN=elmMI PE=1 SV=1 56 227 1.0E-23
sp|O87833|OLEY_STRAT L-olivosyl-oleandolide 3-O-methyltransferase OS=Streptomyces antibioticus GN=oleY PE=1 SV=1 45 225 2.0E-21
sp|Q9ZHQ4|TYLE_STRFR Demethylmacrocin O-methyltransferase OS=Streptomyces fradiae GN=tylE PE=1 SV=1 47 227 3.0E-20
sp|Q83WF2|MYCE_MICGR Mycinamicin VI 2''-O-methyltransferase OS=Micromonospora griseorubida GN=mycE PE=1 SV=1 68 227 7.0E-20

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 5 27 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1465
MRHHCILFSVFSLAVILFATALFRQMGHKATLWLRDKPSSNGLWSNTQPRLIFEQVALKYGTDKVTSHGYQSMYE
KYLPTIRDMPVKMLEIGLGCNMDYGPGASYYTWLEYFPMVDLYFIELDASCVLKFQDKMANAHVFVGDQADIAFL
DQFAAITTADGLFDIVIDDGGHTMKQQITSLERLWPIVKPGGLYVIEDLQTSYLPDYGGDSSKRNMTKLTTMNYL
LEIFGLYGRDLYFEEEREQD
Coding >Ophio5|1465
ATGAGGCACCATTGCATATTATTTTCGGTCTTTAGTCTCGCCGTCATACTATTTGCCACCGCTCTTTTCCGGCAG
ATGGGCCACAAAGCGACTCTTTGGCTCCGGGACAAACCCTCTAGCAACGGCTTGTGGAGCAACACCCAGCCACGC
CTCATTTTCGAACAAGTCGCACTCAAGTATGGGACCGACAAGGTGACGAGCCATGGCTACCAGTCCATGTATGAA
AAGTACCTGCCGACCATTAGAGACATGCCAGTGAAGATGCTTGAGATAGGACTCGGTTGCAATATGGACTACGGC
CCCGGAGCATCCTATTATACATGGCTCGAGTATTTCCCCATGGTCGACCTTTACTTTATTGAGCTTGACGCCTCT
TGCGTACTGAAATTTCAGGATAAGATGGCCAATGCTCATGTGTTCGTGGGCGACCAAGCAGACATCGCCTTCCTC
GATCAGTTCGCTGCGATTACGACTGCAGACGGTCTGTTCGATATTGTCATAGACGATGGGGGGCACACGATGAAG
CAACAAATCACCTCCCTGGAGCGCTTGTGGCCCATCGTGAAGCCCGGGGGACTATACGTGATAGAGGATCTTCAA
ACGAGTTACCTGCCCGACTACGGTGGTGACTCGTCAAAGAGGAACATGACGAAGCTTACAACCATGAACTATCTG
CTGGAAATATTTGGACTGTATGGCAGAGATTTGTACTTTGAGGAAGAGCGAGAACAGGAC
Transcript >Ophio5|1465
ATGAGGCACCATTGCATATTATTTTCGGTCTTTAGTCTCGCCGTCATACTATTTGCCACCGCTCTTTTCCGGCAG
ATGGGCCACAAAGCGACTCTTTGGCTCCGGGACAAACCCTCTAGCAACGGCTTGTGGAGCAACACCCAGCCACGC
CTCATTTTCGAACAAGTCGCACTCAAGTATGGGACCGACAAGGTGACGAGCCATGGCTACCAGTCCATGTATGAA
AAGTACCTGCCGACCATTAGAGACATGCCAGTGAAGATGCTTGAGATAGGACTCGGTTGCAATATGGACTACGGC
CCCGGAGCATCCTATTATACATGGCTCGAGTATTTCCCCATGGTCGACCTTTACTTTATTGAGCTTGACGCCTCT
TGCGTACTGAAATTTCAGGATAAGATGGCCAATGCTCATGTGTTCGTGGGCGACCAAGCAGACATCGCCTTCCTC
GATCAGTTCGCTGCGATTACGACTGCAGACGGTCTGTTCGATATTGTCATAGACGATGGGGGGCACACGATGAAG
CAACAAATCACCTCCCTGGAGCGCTTGTGGCCCATCGTGAAGCCCGGGGGACTATACGTGATAGAGGATCTTCAA
ACGAGTTACCTGCCCGACTACGGTGGTGACTCGTCAAAGAGGAACATGACGAAGCTTACAACCATGAACTATCTG
CTGGAAATATTTGGACTGTATGGCAGAGATTTGTACTTTGAGGAAGAGCGAGAACAGGACTAA
Gene >Ophio5|1465
ATGAGGCACCATTGCATATTATTTTCGGTCTTTAGTCTCGCCGTCATACTATTTGCCACCGCTCTTTTCCGGCAG
ATGGGCCACAAAGCGACTCTTTGGCTCCGGGACAAACCCTCTAGGCATGTGCAAGCCCGACTGATCCGCCATTGC
ATGCTACCAAGGGGCCCTCATACTGACTAGCTGTGCCTGCACAGCAACGGCTTGTGGAGCAACACCCAGCCACGC
CTCATTTTCGAACAAGTCGCACTCAAGTATGGGACCGACAAGGTGACGAGCCATGGCTACCAGTCCATGTATGAA
AAGTACCTGCCGACCATTAGAGACATGCCAGTGAAGATGCTTGAGATAGGACTCGGTTGCAATATGGTATGCCTT
CTTTCTGGCCGACTCCTTACTTGTTGCTAGATGGTGTCTTACTGTCGTGCAAAGGACTACGGCCCCGGAGCATCC
TATTATACATGGCTCGAGTATTTCCCCATGGTCGACCTTTACTTTATTGAGCTTGACGCCTCTTGCGTACTGAAA
TTTCAGGATAAGATGGCCAATGCTCATGTGTTCGTGGGCGACCAAGCAGACATCGCCTTCCTCGATCAGTTCGCT
GCGATTACGACTGCAGACGGTCTGTTCGATATTGTCATAGACGATGGGGGGCACACGATGAAGCAACAAATCACC
TCCCTGGAGCGCTTGTGGCCCATCGTGAAGCCCGGGGGACTATACGTGATAGAGGATCTTCAAACGAGTTACCTG
CCCGACTACGGTGGTGACTCGTCAAAGAGGAACATGACGAAGCTTACAACCATGAACTATCTGCTGGAAATATTG
TGCGACTTGATGACTAAGCGGAAGACTAGACGCATAAGCCATGACTTGTTCTCAGTGGACTGTATGGCAGAGATT
TGTACTTTGAGGAAGAGCGAGAACAGGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail