Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1464
Gene name
Locationscaffold_1500:1152..1508
Strand-
Gene length (bp)356
Transcript length (bp)291
Coding sequence length (bp)288
Protein length (aa) 96

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.509 0.5232 0.4423 0.0826 0.2834 0.1374 0.2405 0.2068 0.2346 0.0423

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 20 42 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup15567
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|1464 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1464
MCCWGWKRRGFHRLRRRGPVFSLSSPLTCTLSPIATYIPTYVDHFETWRRTRASCAPGSSSHAHVCNLPATVAAM
HDEPRLASESRPNQASPASLI
Coding >Ophio5|1464
ATGTGCTGCTGGGGGTGGAAAAGGAGGGGGTTTCATCGGTTGCGGCGAAGGGGGCCCGTCTTCTCACTCTCATCA
CCTCTCACTTGCACCCTTTCACCTATCGCTACCTACATTCCTACTTACGTCGACCATTTCGAGACGTGGCGTCGA
ACACGGGCGTCGTGTGCCCCGGGTAGCAGCAGCCATGCCCATGTGTGCAATCTGCCTGCAACGGTTGCTGCCATG
CATGACGAACCCCGTCTTGCCAGCGAGTCTCGTCCGAATCAGGCATCTCCCGCATCACTGATT
Transcript >Ophio5|1464
ATGTGCTGCTGGGGGTGGAAAAGGAGGGGGTTTCATCGGTTGCGGCGAAGGGGGCCCGTCTTCTCACTCTCATCA
CCTCTCACTTGCACCCTTTCACCTATCGCTACCTACATTCCTACTTACGTCGACCATTTCGAGACGTGGCGTCGA
ACACGGGCGTCGTGTGCCCCGGGTAGCAGCAGCCATGCCCATGTGTGCAATCTGCCTGCAACGGTTGCTGCCATG
CATGACGAACCCCGTCTTGCCAGCGAGTCTCGTCCGAATCAGGCATCTCCCGCATCACTGATTTAG
Gene >Ophio5|1464
ATGTGCTGCTGGGGGTGGAAAAGGAGGGGGTTTCATCGGTTGCGGCGAAGGGGGCCCGTCTTCTCACTCTCATCA
CCTCTCACTTGCACCCTTTCAGTCAGTCTCTCACTTCCTTCTCTACCTTTTTTACCTTCTTACAGCACACCACGG
CCCGGTGAAAGCCTATCGCTACCTACATTCCTACTTACGTCGACCATTTCGAGACGTGGCGTCGAACACGGGCGT
CGTGTGCCCCGGGTAGCAGCAGCCATGCCCATGTGTGCAATCTGCCTGCAACGGTTGCTGCCATGCATGACGAAC
CCCGTCTTGCCAGCGAGTCTCGTCCGAATCAGGCATCTCCCGCATCACTGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail