Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1463
Gene name
Locationscaffold_150:32851..33717
Strand-
Gene length (bp)866
Transcript length (bp)804
Coding sequence length (bp)801
Protein length (aa) 267

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00646 F-box F-box domain 4.3E-08 73 113
PF12937 F-box-like F-box-like 5.6E-08 73 109

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus 0.5366 0.605 0.0242 0.0585 0.4848 0.0984 0.2949 0.1361 0.0732 0.0437

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2522
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|273
Ophiocordyceps australis map64 (Brazil) OphauB2|5367
Ophiocordyceps camponoti-floridani Ophcf2|01334
Ophiocordyceps camponoti-rufipedis Ophun1|6946
Ophiocordyceps kimflemingae Ophio5|1463 (this protein)
Ophiocordyceps subramaniannii Hirsu2|3689

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1463
MSKDPVPALYNGQLTVQRMAAFPATWRLAAVAGPPLLPDDDGEDDLRMTAPDSSSPDDDGGHDDDADAHPCLQSL
PNEILLHILGFLDVNDLLSTSRTSHLFRSLSLSPVLHLYRLRRSRALLPPLLANPDRPSLADLMARSIFLTHTSI
VSRRLARSLVSIRLSRRLAARPSAEALVERAVLPKECVPGMSPVLVSPAIVARRKAIEKEKVKDGLRRWIASKWT
GEVREREEDVRRSEESRGVGRVWRLTRFWERIGRGGDHLTAR
Coding >Ophio5|1463
ATGAGCAAGGATCCCGTGCCGGCCTTGTATAACGGCCAGCTCACCGTGCAGAGGATGGCCGCTTTCCCGGCTACC
TGGCGCTTGGCCGCCGTCGCCGGCCCGCCGCTGCTCCCGGACGACGACGGTGAAGACGATCTCCGGATGACTGCC
CCAGACTCGAGCAGTCCGGACGATGACGGCGGCCACGACGACGACGCCGACGCCCACCCGTGCCTCCAGAGCCTG
CCCAACGAGATCCTGCTCCACATCCTCGGCTTCCTAGACGTCAACGACCTGCTCTCCACGTCAAGAACCAGCCAT
CTCTTCCGCAGCCTCTCCCTCAGCCCTGTCCTCCATCTCTACCGTCTGCGCCGCTCCCGCGCCCTCCTCCCACCC
CTGCTGGCCAACCCGGACCGCCCCTCGCTGGCGGACCTGATGGCCCGTTCCATCTTCCTCACCCACACCTCCATC
GTCTCCCGCCGGCTCGCCCGCTCCCTCGTTTCCATCCGCCTCTCCCGCCGTCTCGCCGCCCGACCCTCGGCCGAG
GCCCTCGTCGAACGGGCCGTCCTGCCCAAGGAATGCGTCCCCGGAATGTCCCCCGTCCTCGTCTCGCCCGCCATC
GTCGCCAGGCGCAAGGCCATCGAGAAGGAAAAAGTCAAGGACGGTCTTCGTCGCTGGATCGCCTCCAAGTGGACC
GGCGAGGTCAGGGAACGTGAGGAGGACGTCAGGAGGTCCGAGGAGAGCCGCGGCGTCGGCCGCGTCTGGCGGCTC
ACCCGCTTCTGGGAGCGCATTGGCCGAGGGGGGGACCACTTGACCGCCAGG
Transcript >Ophio5|1463
ATGAGCAAGGATCCCGTGCCGGCCTTGTATAACGGCCAGCTCACCGTGCAGAGGATGGCCGCTTTCCCGGCTACC
TGGCGCTTGGCCGCCGTCGCCGGCCCGCCGCTGCTCCCGGACGACGACGGTGAAGACGATCTCCGGATGACTGCC
CCAGACTCGAGCAGTCCGGACGATGACGGCGGCCACGACGACGACGCCGACGCCCACCCGTGCCTCCAGAGCCTG
CCCAACGAGATCCTGCTCCACATCCTCGGCTTCCTAGACGTCAACGACCTGCTCTCCACGTCAAGAACCAGCCAT
CTCTTCCGCAGCCTCTCCCTCAGCCCTGTCCTCCATCTCTACCGTCTGCGCCGCTCCCGCGCCCTCCTCCCACCC
CTGCTGGCCAACCCGGACCGCCCCTCGCTGGCGGACCTGATGGCCCGTTCCATCTTCCTCACCCACACCTCCATC
GTCTCCCGCCGGCTCGCCCGCTCCCTCGTTTCCATCCGCCTCTCCCGCCGTCTCGCCGCCCGACCCTCGGCCGAG
GCCCTCGTCGAACGGGCCGTCCTGCCCAAGGAATGCGTCCCCGGAATGTCCCCCGTCCTCGTCTCGCCCGCCATC
GTCGCCAGGCGCAAGGCCATCGAGAAGGAAAAAGTCAAGGACGGTCTTCGTCGCTGGATCGCCTCCAAGTGGACC
GGCGAGGTCAGGGAACGTGAGGAGGACGTCAGGAGGTCCGAGGAGAGCCGCGGCGTCGGCCGCGTCTGGCGGCTC
ACCCGCTTCTGGGAGCGCATTGGCCGAGGGGGGGACCACTTGACCGCCAGGTAA
Gene >Ophio5|1463
ATGAGCAAGGATCCCGTGCCGGCCTTGTATAACGGCCAGCTCACCGTGCAGAGGATGGCCGCTTTCCCGGCTACC
TGGCGCTTGGCCGCCGTCGCCGGCCCGCCGCTGCTCCCGGACGACGACGGTGAAGACGATCTCCGGATGACTGCC
CCAGACTCGAGCAGTCCGGACGATGACGGCGGCCACGACGACGACGCCGACGCCCACCCGTGCCTCCAGAGCCTG
CCCAACGAGATCCTGCTCCACATCCTCGGCTTCCTAGACGTCAACGACCTGCTCTCCACGTCAAGAGTAAGCTAA
CAGTCCCCCCGGGGCCTCTCCTCTCGCAGCAGCGTCTGACCCGCTACTCGCAGACCAGCCATCTCTTCCGCAGCC
TCTCCCTCAGCCCTGTCCTCCATCTCTACCGTCTGCGCCGCTCCCGCGCCCTCCTCCCACCCCTGCTGGCCAACC
CGGACCGCCCCTCGCTGGCGGACCTGATGGCCCGTTCCATCTTCCTCACCCACACCTCCATCGTCTCCCGCCGGC
TCGCCCGCTCCCTCGTTTCCATCCGCCTCTCCCGCCGTCTCGCCGCCCGACCCTCGGCCGAGGCCCTCGTCGAAC
GGGCCGTCCTGCCCAAGGAATGCGTCCCCGGAATGTCCCCCGTCCTCGTCTCGCCCGCCATCGTCGCCAGGCGCA
AGGCCATCGAGAAGGAAAAAGTCAAGGACGGTCTTCGTCGCTGGATCGCCTCCAAGTGGACCGGCGAGGTCAGGG
AACGTGAGGAGGACGTCAGGAGGTCCGAGGAGAGCCGCGGCGTCGGCCGCGTCTGGCGGCTCACCCGCTTCTGGG
AGCGCATTGGCCGAGGGGGGGACCACTTGACCGCCAGGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail