Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1458
Gene name
Locationscaffold_150:23285..24423
Strand+
Gene length (bp)1138
Transcript length (bp)927
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 3.1E-27 109 257

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 52 288 1.0E-46
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 32 266 2.0E-44
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 35 268 2.0E-36
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 35 268 3.0E-36
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 35 269 5.0E-36
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 52 288 1.0E-46
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 32 266 2.0E-44
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 35 268 2.0E-36
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 35 268 3.0E-36
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 35 269 5.0E-36
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 34 269 6.0E-35
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 48 263 2.0E-33
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 67 278 4.0E-33
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 28 258 7.0E-33
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 27 259 5.0E-32
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 25 258 3.0E-28
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 72 271 3.0E-26
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 38 260 2.0E-18
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 32 260 7.0E-16
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 52 245 3.0E-14
sp|Q3SZE3|PLPP3_BOVIN Phospholipid phosphatase 3 OS=Bos taurus GN=PLPP3 PE=2 SV=1 48 249 6.0E-12
sp|O14495|PLPP3_HUMAN Phospholipid phosphatase 3 OS=Homo sapiens GN=PLPP3 PE=1 SV=1 48 249 8.0E-12
sp|Q99JY8|PLPP3_MOUSE Phospholipid phosphatase 3 OS=Mus musculus GN=Plpp3 PE=1 SV=1 32 249 8.0E-12
sp|P97544|PLPP3_RAT Phospholipid phosphatase 3 OS=Rattus norvegicus GN=Plpp3 PE=1 SV=1 32 249 8.0E-12
sp|O08564|PLPP1_RAT Phospholipid phosphatase 1 OS=Rattus norvegicus GN=Plpp1 PE=1 SV=1 43 249 1.0E-11
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 107 274 1.0E-11
sp|Q7Z2D5|LPPR4_HUMAN Lipid phosphate phosphatase-related protein type 4 OS=Homo sapiens GN=LPPR4 PE=1 SV=1 43 251 5.0E-11
sp|Q7TME0|LPPR4_MOUSE Lipid phosphate phosphatase-related protein type 4 OS=Mus musculus GN=Lppr4 PE=1 SV=2 43 251 1.0E-10
sp|Q8TBJ4|LPPR1_HUMAN Lipid phosphate phosphatase-related protein type 1 OS=Homo sapiens GN=LPPR1 PE=2 SV=1 61 251 5.0E-08
sp|Q6WAY2|LPPR1_RAT Lipid phosphate phosphatase-related protein type 1 OS=Rattus norvegicus GN=Lppr1 PE=2 SV=1 61 251 4.0E-07
sp|Q8BFZ2|LPPR1_MOUSE Lipid phosphate phosphatase-related protein type 1 OS=Mus musculus GN=Lppr1 PE=1 SV=1 61 251 6.0E-07
sp|Q7TPB0|LPPR3_MOUSE Lipid phosphate phosphatase-related protein type 3 OS=Mus musculus GN=Lppr3 PE=1 SV=1 119 293 1.0E-06
sp|A4II83|LPPR1_XENTR Lipid phosphate phosphatase-related protein type 1 OS=Xenopus tropicalis GN=lppr1 PE=2 SV=1 57 251 2.0E-06
sp|Q7TMB0|LPPR3_RAT Lipid phosphate phosphatase-related protein type 3 OS=Rattus norvegicus GN=Lppr3 PE=2 SV=1 119 293 2.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 63 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 73 95 22
3 107 126 19
4 178 200 22
5 207 226 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1458
MPSGPQGRASTPAGSRSMSRLARVWKTTHAPDYTGLFLLLIGWLSLASLVTPFHRMFFINDLAISFPHAEHERVS
VPLVLVCAFLLPLAVFICYGLAFRPSAAKQEAIYLSFAVAAVLTGFLTDVVKNAVGRPRPDLLARCRPASGTKPN
HLVTIDVCTAPDGHTLHDGWRSFPSGHSSFSFAGLGFLSLFLAGQLHLFGAAGSRDLSRALLCLLPLIGATLIAI
SRCEDYRHDVYDVCCGSALGMSVAYWSYRRHWPKLSSPTCDTPLPRPGSETRAPYWHRVRDEETGAPGLGTGYEM
DEMSTTPA
Coding >Ophio5|1458
ATGCCGTCCGGCCCGCAAGGCAGGGCGTCGACTCCGGCCGGTAGCCGCAGCATGTCACGGCTGGCCCGAGTCTGG
AAGACGACGCATGCGCCAGACTACACCGGCCTATTTCTGCTACTGATCGGATGGCTTTCTTTGGCCAGCCTCGTT
ACGCCTTTCCACCGCATGTTCTTTATCAACGACCTCGCCATCTCCTTTCCTCACGCCGAACACGAGCGCGTTTCC
GTGCCCTTGGTCCTCGTTTGTGCCTTTTTGCTCCCGCTCGCCGTCTTCATCTGCTACGGCCTCGCATTCCGGCCC
TCGGCCGCCAAGCAGGAAGCCATCTACTTGTCCTTTGCCGTCGCCGCCGTGCTTACGGGTTTTCTCACCGACGTC
GTCAAGAATGCCGTCGGCCGGCCTCGTCCCGACCTGCTGGCCCGCTGCCGTCCGGCCTCGGGCACCAAGCCGAAT
CACCTCGTCACCATCGACGTGTGCACCGCGCCAGATGGCCACACGCTGCACGACGGCTGGCGCTCGTTTCCCTCC
GGACACTCATCCTTCTCGTTTGCCGGCCTCGGCTTCCTGAGCCTCTTCCTCGCCGGCCAGCTACATTTGTTCGGC
GCAGCTGGCAGCCGGGACCTTAGCCGTGCTCTGCTCTGCCTACTCCCTCTCATCGGTGCCACACTCATCGCCATC
TCCCGATGCGAAGACTATCGCCACGATGTCTATGACGTCTGCTGCGGCTCCGCGCTGGGCATGTCTGTTGCCTAC
TGGAGCTATCGAAGGCATTGGCCGAAGCTCTCTAGTCCCACGTGTGACACGCCGTTGCCGCGTCCCGGTTCGGAG
ACGAGGGCGCCGTATTGGCACCGAGTCAGGGATGAGGAAACGGGCGCCCCCGGCTTAGGGACTGGCTACGAGATG
GATGAGATGTCGACGACGCCTGCC
Transcript >Ophio5|1458
ATGCCGTCCGGCCCGCAAGGCAGGGCGTCGACTCCGGCCGGTAGCCGCAGCATGTCACGGCTGGCCCGAGTCTGG
AAGACGACGCATGCGCCAGACTACACCGGCCTATTTCTGCTACTGATCGGATGGCTTTCTTTGGCCAGCCTCGTT
ACGCCTTTCCACCGCATGTTCTTTATCAACGACCTCGCCATCTCCTTTCCTCACGCCGAACACGAGCGCGTTTCC
GTGCCCTTGGTCCTCGTTTGTGCCTTTTTGCTCCCGCTCGCCGTCTTCATCTGCTACGGCCTCGCATTCCGGCCC
TCGGCCGCCAAGCAGGAAGCCATCTACTTGTCCTTTGCCGTCGCCGCCGTGCTTACGGGTTTTCTCACCGACGTC
GTCAAGAATGCCGTCGGCCGGCCTCGTCCCGACCTGCTGGCCCGCTGCCGTCCGGCCTCGGGCACCAAGCCGAAT
CACCTCGTCACCATCGACGTGTGCACCGCGCCAGATGGCCACACGCTGCACGACGGCTGGCGCTCGTTTCCCTCC
GGACACTCATCCTTCTCGTTTGCCGGCCTCGGCTTCCTGAGCCTCTTCCTCGCCGGCCAGCTACATTTGTTCGGC
GCAGCTGGCAGCCGGGACCTTAGCCGTGCTCTGCTCTGCCTACTCCCTCTCATCGGTGCCACACTCATCGCCATC
TCCCGATGCGAAGACTATCGCCACGATGTCTATGACGTCTGCTGCGGCTCCGCGCTGGGCATGTCTGTTGCCTAC
TGGAGCTATCGAAGGCATTGGCCGAAGCTCTCTAGTCCCACGTGTGACACGCCGTTGCCGCGTCCCGGTTCGGAG
ACGAGGGCGCCGTATTGGCACCGAGTCAGGGATGAGGAAACGGGCGCCCCCGGCTTAGGGACTGGCTACGAGATG
GATGAGATGTCGACGACGCCTGCCTGA
Gene >Ophio5|1458
ATGCCGTCCGGCCCGCAAGGCAGGGCGTCGACTCCGGCCGGTAGCCGCAGCATGTCACGGCTGGCCCGAGTCTGG
AAGGTCAGCCAGCCCTCATCGTATAGCCGGTCGGAGAAAGGGGGGTGAGAGCGGGGCGTTCGTTGCCTTTGACGC
TCACACACTCGAGTAGACGACGCATGCGCCAGACTACACCGGCCTATTTCTGCTACTGATCGGATGGCTTTCTGT
GAGTTCTCGAATTCTCCCGTGCCTTGACCGCTCTCCAAGCCTGACATTGCTCGTCTCTCAAGTTGGCCAGCCTCG
TTACGCCTTTCCACCGCATGTTCTTTATCAACGACCTCGCCATCTCCTTTCCTCACGCCGAACACGAGCGCGTTT
CCGTGCGTGAGTCTCCCAAGCCCGACCGCTTGCTCGTCGAGGAAGCTCACCGCTGCCCACCGTAGCCTTGGTCCT
CGTTTGTGCCTTTTTGCTCCCGCTCGCCGTCTTCATCTGCTACGGCCTCGCATTCCGGCCCTCGGCCGCCAAGCA
GGAAGCCATCTACTTGTCCTTTGCCGTCGCCGCCGTGCTTACGGGTTTTCTCACCGACGTCGTCAAGAATGCCGT
CGGCCGGCCTCGTCCCGACCTGCTGGCCCGCTGCCGTCCGGCCTCGGGCACCAAGCCGAATCACCTCGTCACCAT
CGACGTGTGCACCGCGCCAGATGGCCACACGCTGCACGACGGCTGGCGCTCGTTTCCCTCCGGACACTCATCCTT
CTCGTTTGCCGGCCTCGGCTTCCTGAGCCTCTTCCTCGCCGGCCAGCTACATTTGTTCGGCGCAGCTGGCAGCCG
GGACCTTAGCCGTGCTCTGCTCTGCCTACTCCCTCTCATCGGTGCCACACTCATCGCCATCTCCCGATGCGAAGA
CTATCGCCACGATGTCTATGACGTCTGCTGCGGCTCCGCGCTGGGCATGTCTGTTGCCTACTGGAGCTATCGAAG
GCATTGGCCGAAGCTCTCTAGTCCCACGTGTGACACGCCGTTGCCGCGTCCCGGTTCGGAGACGAGGGCGCCGTA
TTGGCACCGAGTCAGGGATGAGGAAACGGGCGCCCCCGGCTTAGGGACTGGCTACGAGATGGATGAGATGTCGAC
GACGCCTGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail