Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1457
Gene name
Locationscaffold_150:21067..22747
Strand-
Gene length (bp)1680
Transcript length (bp)1680
Coding sequence length (bp)1677
Protein length (aa) 559

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01846 FF FF domain 5.6E-11 280 330
PF00397 WW WW domain 7.2E-09 19 48

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09685|DRE4_SCHPO Pre-mRNA-splicing factor dre4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dre4 PE=1 SV=1 16 455 6.0E-37
sp|Q8CGF7|TCRG1_MOUSE Transcription elongation regulator 1 OS=Mus musculus GN=Tcerg1 PE=1 SV=2 9 513 1.0E-14
sp|Q9LT25|PR40C_ARATH Pre-mRNA-processing protein 40C OS=Arabidopsis thaliana GN=MED35C PE=1 SV=1 23 511 2.0E-08
sp|F4JCC1|PR35B_ARATH Pre-mRNA-processing protein 40B OS=Arabidopsis thaliana GN=PRP40B PE=1 SV=1 23 403 8.0E-06

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1457
MLKSTYKPSAAALAAAAPLPPGWTEHKAPTGHSYYYNANTKQSTYRRPGLPVAEAQPLPSLVSSPAPPYAHIPTL
SDPRVANAYVAQFAPTPAPPRDNARAGLQGRPRPQPVDKPVRKEAIPGYEPWVLVYTKYSRRFVHHPIKNTSFWR
IPEKLLTGVLELDKARVRAKASGDGGDEKDEGNQGGKMEKPADIAVPGEDDGEASEYEEVEVSDDDLDDEHRSKR
QRTGESASGDEGERDEVVEFTEADIAAQLQMMGDDDAADWPEDLNGVPAFSEDDAKCLFKDLLDDFDINPYSPWD
KLVEEGRLVDDPRYTALTTMRTRKECWDEWSRERIASRLEQRAKQEVKDPKIAYLALLQDKATPKLYWPEFKRKY
KKEAPMRDAKLSDKDREKAYREHIGRLKLPHATLKSDLMALLKAQPNHLLHVRSLSDGLPTPVLTDIRYISLAPQ
ERDALVEAYVQSLPPPPPAGEDIDDAEREDRKRECEARERRERALEEHNRAVEEQRRMRAREVAASKARLRQGER
EIEMAMRVDKRGLQSQLARELTDKPTEPSPGEPN
Coding >Ophio5|1457
ATGCTGAAATCCACATACAAGCCTTCTGCCGCCGCCCTGGCCGCAGCAGCGCCGCTTCCACCCGGATGGACGGAG
CATAAGGCGCCCACAGGCCACAGCTATTACTACAATGCCAACACCAAGCAGTCAACCTACCGCCGTCCCGGACTA
CCCGTCGCTGAAGCTCAGCCCCTGCCGTCTCTCGTGTCGTCTCCCGCGCCGCCATACGCGCACATCCCGACCCTC
TCCGATCCCCGCGTTGCAAATGCCTATGTCGCCCAGTTCGCCCCGACGCCCGCGCCGCCTCGAGACAATGCTCGC
GCAGGCCTCCAGGGGCGGCCGCGTCCGCAGCCGGTAGACAAACCTGTGCGGAAAGAGGCCATACCGGGGTACGAG
CCGTGGGTGCTCGTTTACACAAAATATTCAAGGCGCTTCGTCCACCATCCTATCAAAAACACCAGCTTCTGGCGC
ATCCCGGAGAAGCTACTGACCGGTGTCCTGGAGCTAGACAAGGCGCGAGTGCGGGCCAAGGCGTCTGGTGATGGA
GGGGACGAAAAGGATGAGGGCAACCAAGGCGGCAAGATGGAAAAGCCTGCCGACATTGCCGTCCCAGGCGAGGAC
GACGGCGAAGCCTCCGAGTACGAGGAGGTCGAGGTCAGCGATGACGACCTAGACGACGAGCATCGCTCGAAGCGG
CAACGAACGGGCGAGTCTGCTAGCGGCGACGAGGGCGAGAGGGACGAGGTCGTCGAGTTCACCGAAGCGGACATT
GCCGCGCAGCTACAGATGATGGGCGACGACGACGCGGCAGACTGGCCCGAGGACCTCAACGGGGTACCCGCATTC
TCCGAGGACGATGCCAAATGTCTCTTCAAAGATCTTCTCGACGACTTCGACATCAATCCCTACAGTCCCTGGGAT
AAGCTCGTCGAAGAGGGCCGTCTCGTCGACGACCCGCGCTACACTGCGCTGACCACGATGCGAACGCGCAAGGAG
TGCTGGGACGAGTGGTCACGGGAGAGGATCGCGTCGCGTCTGGAGCAGAGGGCCAAGCAGGAGGTCAAGGACCCC
AAGATTGCGTACTTGGCTCTCCTACAAGACAAGGCGACGCCCAAGTTGTACTGGCCCGAATTTAAGCGCAAGTAC
AAGAAGGAAGCGCCGATGAGGGACGCCAAGCTGTCCGATAAGGACCGGGAAAAGGCGTATCGCGAGCACATTGGC
CGATTGAAGCTGCCGCACGCCACGCTCAAGTCGGACCTGATGGCACTGCTCAAGGCGCAACCCAACCACCTGCTG
CACGTGAGGTCTCTCTCGGACGGTCTGCCGACGCCGGTCCTGACCGACATCCGCTACATATCGCTCGCGCCCCAG
GAGCGTGACGCGCTCGTCGAGGCCTACGTGCAGTCGCTGCCGCCACCGCCACCGGCCGGTGAGGACATCGACGAC
GCGGAAAGGGAAGACAGGAAGAGAGAGTGTGAGGCGCGAGAAAGGCGCGAGAGGGCACTGGAGGAGCACAATCGC
GCGGTCGAGGAACAGCGGAGGATGAGGGCTCGGGAGGTGGCTGCTAGCAAGGCGCGGCTGCGACAGGGGGAGAGA
GAGATTGAGATGGCGATGCGGGTGGACAAAAGGGGACTGCAGAGTCAGCTCGCTCGCGAGCTGACAGACAAGCCG
ACCGAGCCGTCGCCGGGAGAGCCCAAT
Transcript >Ophio5|1457
ATGCTGAAATCCACATACAAGCCTTCTGCCGCCGCCCTGGCCGCAGCAGCGCCGCTTCCACCCGGATGGACGGAG
CATAAGGCGCCCACAGGCCACAGCTATTACTACAATGCCAACACCAAGCAGTCAACCTACCGCCGTCCCGGACTA
CCCGTCGCTGAAGCTCAGCCCCTGCCGTCTCTCGTGTCGTCTCCCGCGCCGCCATACGCGCACATCCCGACCCTC
TCCGATCCCCGCGTTGCAAATGCCTATGTCGCCCAGTTCGCCCCGACGCCCGCGCCGCCTCGAGACAATGCTCGC
GCAGGCCTCCAGGGGCGGCCGCGTCCGCAGCCGGTAGACAAACCTGTGCGGAAAGAGGCCATACCGGGGTACGAG
CCGTGGGTGCTCGTTTACACAAAATATTCAAGGCGCTTCGTCCACCATCCTATCAAAAACACCAGCTTCTGGCGC
ATCCCGGAGAAGCTACTGACCGGTGTCCTGGAGCTAGACAAGGCGCGAGTGCGGGCCAAGGCGTCTGGTGATGGA
GGGGACGAAAAGGATGAGGGCAACCAAGGCGGCAAGATGGAAAAGCCTGCCGACATTGCCGTCCCAGGCGAGGAC
GACGGCGAAGCCTCCGAGTACGAGGAGGTCGAGGTCAGCGATGACGACCTAGACGACGAGCATCGCTCGAAGCGG
CAACGAACGGGCGAGTCTGCTAGCGGCGACGAGGGCGAGAGGGACGAGGTCGTCGAGTTCACCGAAGCGGACATT
GCCGCGCAGCTACAGATGATGGGCGACGACGACGCGGCAGACTGGCCCGAGGACCTCAACGGGGTACCCGCATTC
TCCGAGGACGATGCCAAATGTCTCTTCAAAGATCTTCTCGACGACTTCGACATCAATCCCTACAGTCCCTGGGAT
AAGCTCGTCGAAGAGGGCCGTCTCGTCGACGACCCGCGCTACACTGCGCTGACCACGATGCGAACGCGCAAGGAG
TGCTGGGACGAGTGGTCACGGGAGAGGATCGCGTCGCGTCTGGAGCAGAGGGCCAAGCAGGAGGTCAAGGACCCC
AAGATTGCGTACTTGGCTCTCCTACAAGACAAGGCGACGCCCAAGTTGTACTGGCCCGAATTTAAGCGCAAGTAC
AAGAAGGAAGCGCCGATGAGGGACGCCAAGCTGTCCGATAAGGACCGGGAAAAGGCGTATCGCGAGCACATTGGC
CGATTGAAGCTGCCGCACGCCACGCTCAAGTCGGACCTGATGGCACTGCTCAAGGCGCAACCCAACCACCTGCTG
CACGTGAGGTCTCTCTCGGACGGTCTGCCGACGCCGGTCCTGACCGACATCCGCTACATATCGCTCGCGCCCCAG
GAGCGTGACGCGCTCGTCGAGGCCTACGTGCAGTCGCTGCCGCCACCGCCACCGGCCGGTGAGGACATCGACGAC
GCGGAAAGGGAAGACAGGAAGAGAGAGTGTGAGGCGCGAGAAAGGCGCGAGAGGGCACTGGAGGAGCACAATCGC
GCGGTCGAGGAACAGCGGAGGATGAGGGCTCGGGAGGTGGCTGCTAGCAAGGCGCGGCTGCGACAGGGGGAGAGA
GAGATTGAGATGGCGATGCGGGTGGACAAAAGGGGACTGCAGAGTCAGCTCGCTCGCGAGCTGACAGACAAGCCG
ACCGAGCCGTCGCCGGGAGAGCCCAATTAA
Gene >Ophio5|1457
ATGCTGAAATCCACATACAAGCCTTCTGCCGCCGCCCTGGCCGCAGCAGCGCCGCTTCCACCCGGATGGACGGAG
CATAAGGCGCCCACAGGCCACAGCTATTACTACAATGCCAACACCAAGCAGTCAACCTACCGCCGTCCCGGACTA
CCCGTCGCTGAAGCTCAGCCCCTGCCGTCTCTCGTGTCGTCTCCCGCGCCGCCATACGCGCACATCCCGACCCTC
TCCGATCCCCGCGTTGCAAATGCCTATGTCGCCCAGTTCGCCCCGACGCCCGCGCCGCCTCGAGACAATGCTCGC
GCAGGCCTCCAGGGGCGGCCGCGTCCGCAGCCGGTAGACAAACCTGTGCGGAAAGAGGCCATACCGGGGTACGAG
CCGTGGGTGCTCGTTTACACAAAATATTCAAGGCGCTTCGTCCACCATCCTATCAAAAACACCAGCTTCTGGCGC
ATCCCGGAGAAGCTACTGACCGGTGTCCTGGAGCTAGACAAGGCGCGAGTGCGGGCCAAGGCGTCTGGTGATGGA
GGGGACGAAAAGGATGAGGGCAACCAAGGCGGCAAGATGGAAAAGCCTGCCGACATTGCCGTCCCAGGCGAGGAC
GACGGCGAAGCCTCCGAGTACGAGGAGGTCGAGGTCAGCGATGACGACCTAGACGACGAGCATCGCTCGAAGCGG
CAACGAACGGGCGAGTCTGCTAGCGGCGACGAGGGCGAGAGGGACGAGGTCGTCGAGTTCACCGAAGCGGACATT
GCCGCGCAGCTACAGATGATGGGCGACGACGACGCGGCAGACTGGCCCGAGGACCTCAACGGGGTACCCGCATTC
TCCGAGGACGATGCCAAATGTCTCTTCAAAGATCTTCTCGACGACTTCGACATCAATCCCTACAGTCCCTGGGAT
AAGCTCGTCGAAGAGGGCCGTCTCGTCGACGACCCGCGCTACACTGCGCTGACCACGATGCGAACGCGCAAGGAG
TGCTGGGACGAGTGGTCACGGGAGAGGATCGCGTCGCGTCTGGAGCAGAGGGCCAAGCAGGAGGTCAAGGACCCC
AAGATTGCGTACTTGGCTCTCCTACAAGACAAGGCGACGCCCAAGTTGTACTGGCCCGAATTTAAGCGCAAGTAC
AAGAAGGAAGCGCCGATGAGGGACGCCAAGCTGTCCGATAAGGACCGGGAAAAGGCGTATCGCGAGCACATTGGC
CGATTGAAGCTGCCGCACGCCACGCTCAAGTCGGACCTGATGGCACTGCTCAAGGCGCAACCCAACCACCTGCTG
CACGTGAGGTCTCTCTCGGACGGTCTGCCGACGCCGGTCCTGACCGACATCCGCTACATATCGCTCGCGCCCCAG
GAGCGTGACGCGCTCGTCGAGGCCTACGTGCAGTCGCTGCCGCCACCGCCACCGGCCGGTGAGGACATCGACGAC
GCGGAAAGGGAAGACAGGAAGAGAGAGTGTGAGGCGCGAGAAAGGCGCGAGAGGGCACTGGAGGAGCACAATCGC
GCGGTCGAGGAACAGCGGAGGATGAGGGCTCGGGAGGTGGCTGCTAGCAAGGCGCGGCTGCGACAGGGGGAGAGA
GAGATTGAGATGGCGATGCGGGTGGACAAAAGGGGACTGCAGAGTCAGCTCGCTCGCGAGCTGACAGACAAGCCG
ACCGAGCCGTCGCCGGGAGAGCCCAATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail