Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1456
Gene name
Locationscaffold_150:19361..20985
Strand+
Gene length (bp)1624
Transcript length (bp)1554
Coding sequence length (bp)1551
Protein length (aa) 517

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 3.4E-19 311 495
PF00293 NUDIX NUDIX domain 7.4E-11 16 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O58185|EI2BL_PYRHO Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 315 494 1.0E-09
sp|Q7UF90|MTNA_RHOBA Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 335 500 1.0E-08
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 315 493 1.0E-07
sp|A4ILL1|MTNA_GEOTN Methylthioribose-1-phosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnA PE=3 SV=1 314 497 2.0E-07
sp|A4VLZ8|MTNA_PSEU5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 287 493 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O58185|EI2BL_PYRHO Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 315 494 1.0E-09
sp|Q7UF90|MTNA_RHOBA Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 335 500 1.0E-08
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 315 493 1.0E-07
sp|A4ILL1|MTNA_GEOTN Methylthioribose-1-phosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnA PE=3 SV=1 314 497 2.0E-07
sp|A4VLZ8|MTNA_PSEU5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 287 493 2.0E-07
sp|Q4K8M6|MTNA_PSEF5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mtnA PE=3 SV=1 287 504 3.0E-07
sp|Q9V281|R15PI_PYRAB Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 315 493 4.0E-07
sp|B1J5G5|MTNA_PSEPW Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain W619) GN=mtnA PE=3 SV=1 334 510 6.0E-07
sp|A4XTE5|MTNA_PSEMY Methylthioribose-1-phosphate isomerase OS=Pseudomonas mendocina (strain ymp) GN=mtnA PE=3 SV=1 334 504 8.0E-07
sp|A7GS56|MTNA_BACCN Methylthioribose-1-phosphate isomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mtnA PE=3 SV=1 314 497 1.0E-06
sp|A6V2Q6|MTNA_PSEA7 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain PA7) GN=mtnA PE=3 SV=1 287 493 1.0E-06
sp|C5D7U5|MTNA_GEOSW Methylthioribose-1-phosphate isomerase OS=Geobacillus sp. (strain WCH70) GN=mtnA PE=3 SV=1 314 507 3.0E-06
sp|A6LE92|MTNA_PARD8 Methylthioribose-1-phosphate isomerase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mtnA PE=3 SV=2 334 493 4.0E-06
sp|A5W7G2|MTNA_PSEP1 Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mtnA PE=3 SV=1 334 504 4.0E-06
sp|Q48FM6|MTNA_PSE14 Methylthioribose-1-phosphate isomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mtnA PE=3 SV=1 287 504 5.0E-06
sp|Q8KBH1|MTNA_CHLTE Methylthioribose-1-phosphate isomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mtnA PE=3 SV=1 299 504 5.0E-06
sp|Q99LC8|EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus GN=Eif2b1 PE=1 SV=1 314 495 6.0E-06
sp|B0KTX5|MTNA_PSEPG Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain GB-1) GN=mtnA PE=3 SV=1 334 504 8.0E-06
sp|Q885T7|MTNA_PSESM Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mtnA PE=3 SV=1 287 504 8.0E-06
sp|Q9HZ65|MTNA_PSEAE Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mtnA PE=3 SV=1 287 493 9.0E-06
sp|Q02PX5|MTNA_PSEAB Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mtnA PE=3 SV=1 287 493 9.0E-06
sp|B7V9J7|MTNA_PSEA8 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=mtnA PE=3 SV=1 287 493 9.0E-06
sp|Q4ZQ92|MTNA_PSEU2 Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mtnA PE=3 SV=2 287 504 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1456
MATVPEKRAVAGSFIFRLSPEGRRPQVALFRRSAEVRTYRHRYAPISGSVEADDADALTTAWRELAEETGLGPSS
LRLLRQGKPYSFVDEAVGREWTINPFAFALRTDGPGEAAIKLDREHESFAWFDPAEIPEDDNDGGDIDATSSSFR
GVPHLLDSLRRVWFELELRPAAAAAVLDDGLRRLRDDHTSGARQLASVALDTLIRVLPVLHRPPNDSARWWRSLR
IAAWHLWKNGREAMGASILRLLLDALTLVETKLPPDGTDSLPDGFIDNVLDALQGIAQRRLESGAALQEAFASFV
RRDQATRADTSPIRIISLSSSATVASCLDRALAQGLALDVHVLESRPLFEGASMARAIAASIRAAGNLPGASVSV
HTDASVALAARGANILLLGADLIDASGNVSNKTGSLPAVLAVRHVAPAVKVVVVAESEKVLPLDSPSASEDNNPD
QVSRAWADDDRAATQAGNVHLSNVYFEWVPAGLIDSYITEAGVATGEDIAGLARDARARLDRFFSNL
Coding >Ophio5|1456
ATGGCCACGGTGCCCGAGAAGCGCGCCGTAGCCGGCAGCTTCATCTTTCGACTCAGCCCCGAGGGCCGACGGCCT
CAGGTGGCGTTGTTTCGGAGGAGCGCCGAGGTAAGGACGTACCGGCATCGCTATGCGCCCATCTCCGGCAGCGTC
GAGGCGGACGACGCCGATGCGCTGACGACGGCTTGGCGAGAGCTCGCTGAGGAGACGGGTCTAGGACCTAGCTCG
CTTCGTCTGCTGCGCCAGGGCAAGCCTTACTCGTTCGTCGACGAGGCTGTTGGCCGCGAGTGGACTATCAATCCC
TTTGCTTTCGCTCTGCGCACAGATGGGCCCGGCGAGGCTGCTATCAAACTCGATCGCGAGCATGAGAGCTTCGCC
TGGTTCGACCCGGCCGAAATTCCTGAAGACGACAACGATGGCGGCGACATAGACGCTACCTCTTCGTCCTTTCGC
GGCGTCCCGCATCTCCTCGACAGCCTGCGCCGCGTCTGGTTTGAGCTCGAGCTCCGTCCCGCCGCCGCCGCTGCC
GTCCTCGACGACGGCTTGCGCCGTCTGCGCGACGATCACACCAGCGGTGCTCGACAGCTGGCTTCGGTCGCCCTC
GATACCTTGATCCGTGTCTTGCCCGTTCTCCATCGTCCGCCCAATGACTCGGCTCGCTGGTGGCGCAGCCTGCGT
ATCGCCGCCTGGCACCTGTGGAAAAACGGCCGCGAAGCCATGGGCGCCTCTATTCTTCGCCTGCTTCTCGATGCC
CTGACCCTCGTCGAGACGAAATTACCCCCTGATGGCACAGACAGTCTACCTGACGGCTTCATCGACAACGTCCTC
GACGCCTTACAGGGAATCGCTCAGCGGCGGCTCGAATCCGGCGCGGCGCTCCAAGAAGCCTTCGCCTCCTTCGTC
CGTCGTGACCAGGCCACCCGCGCCGACACCTCGCCTATCCGTATCATCAGCCTCTCATCCAGCGCGACCGTCGCC
TCGTGCCTCGACCGCGCCCTCGCCCAGGGACTCGCTCTCGACGTGCACGTGCTCGAGTCCCGCCCGCTCTTCGAG
GGCGCCTCCATGGCCCGCGCCATCGCCGCCTCCATACGCGCCGCGGGGAACCTCCCGGGGGCCAGCGTCTCCGTT
CATACCGATGCCAGTGTCGCCCTCGCCGCCCGCGGCGCCAACATTCTCCTCCTTGGTGCCGACCTTATCGACGCG
AGCGGCAACGTCAGCAACAAGACGGGCTCGCTGCCTGCCGTCCTCGCTGTTCGTCACGTCGCCCCTGCCGTCAAG
GTTGTTGTCGTCGCCGAGAGCGAAAAGGTACTGCCTCTCGACTCTCCCTCGGCATCTGAGGACAATAACCCGGAC
CAAGTCTCGCGCGCCTGGGCAGACGATGACCGTGCAGCCACTCAGGCGGGTAATGTCCACCTCTCCAACGTCTAC
TTCGAGTGGGTGCCGGCCGGCCTCATCGACTCCTACATCACCGAGGCTGGCGTCGCGACGGGGGAGGATATCGCT
GGCTTGGCGCGAGACGCTCGGGCGCGGCTGGACCGTTTCTTCTCCAATTTG
Transcript >Ophio5|1456
ATGGCCACGGTGCCCGAGAAGCGCGCCGTAGCCGGCAGCTTCATCTTTCGACTCAGCCCCGAGGGCCGACGGCCT
CAGGTGGCGTTGTTTCGGAGGAGCGCCGAGGTAAGGACGTACCGGCATCGCTATGCGCCCATCTCCGGCAGCGTC
GAGGCGGACGACGCCGATGCGCTGACGACGGCTTGGCGAGAGCTCGCTGAGGAGACGGGTCTAGGACCTAGCTCG
CTTCGTCTGCTGCGCCAGGGCAAGCCTTACTCGTTCGTCGACGAGGCTGTTGGCCGCGAGTGGACTATCAATCCC
TTTGCTTTCGCTCTGCGCACAGATGGGCCCGGCGAGGCTGCTATCAAACTCGATCGCGAGCATGAGAGCTTCGCC
TGGTTCGACCCGGCCGAAATTCCTGAAGACGACAACGATGGCGGCGACATAGACGCTACCTCTTCGTCCTTTCGC
GGCGTCCCGCATCTCCTCGACAGCCTGCGCCGCGTCTGGTTTGAGCTCGAGCTCCGTCCCGCCGCCGCCGCTGCC
GTCCTCGACGACGGCTTGCGCCGTCTGCGCGACGATCACACCAGCGGTGCTCGACAGCTGGCTTCGGTCGCCCTC
GATACCTTGATCCGTGTCTTGCCCGTTCTCCATCGTCCGCCCAATGACTCGGCTCGCTGGTGGCGCAGCCTGCGT
ATCGCCGCCTGGCACCTGTGGAAAAACGGCCGCGAAGCCATGGGCGCCTCTATTCTTCGCCTGCTTCTCGATGCC
CTGACCCTCGTCGAGACGAAATTACCCCCTGATGGCACAGACAGTCTACCTGACGGCTTCATCGACAACGTCCTC
GACGCCTTACAGGGAATCGCTCAGCGGCGGCTCGAATCCGGCGCGGCGCTCCAAGAAGCCTTCGCCTCCTTCGTC
CGTCGTGACCAGGCCACCCGCGCCGACACCTCGCCTATCCGTATCATCAGCCTCTCATCCAGCGCGACCGTCGCC
TCGTGCCTCGACCGCGCCCTCGCCCAGGGACTCGCTCTCGACGTGCACGTGCTCGAGTCCCGCCCGCTCTTCGAG
GGCGCCTCCATGGCCCGCGCCATCGCCGCCTCCATACGCGCCGCGGGGAACCTCCCGGGGGCCAGCGTCTCCGTT
CATACCGATGCCAGTGTCGCCCTCGCCGCCCGCGGCGCCAACATTCTCCTCCTTGGTGCCGACCTTATCGACGCG
AGCGGCAACGTCAGCAACAAGACGGGCTCGCTGCCTGCCGTCCTCGCTGTTCGTCACGTCGCCCCTGCCGTCAAG
GTTGTTGTCGTCGCCGAGAGCGAAAAGGTACTGCCTCTCGACTCTCCCTCGGCATCTGAGGACAATAACCCGGAC
CAAGTCTCGCGCGCCTGGGCAGACGATGACCGTGCAGCCACTCAGGCGGGTAATGTCCACCTCTCCAACGTCTAC
TTCGAGTGGGTGCCGGCCGGCCTCATCGACTCCTACATCACCGAGGCTGGCGTCGCGACGGGGGAGGATATCGCT
GGCTTGGCGCGAGACGCTCGGGCGCGGCTGGACCGTTTCTTCTCCAATTTGTGA
Gene >Ophio5|1456
ATGGCCACGGTGCCCGAGAAGCGCGCCGTAGCCGGCAGCTTCATCTTTCGACTCAGCCCCGAGGGCCGACGGCCT
CAGGTGGCGTTGTTTCGGAGGAGCGCCGAGGTAAGGACGTACCGGTAGGTCCCTTGTCGTCCGCATGCGTCCTGG
CCGAGCTCAGCTGGGAGCGTAAATCGTCTCGAGTTTCAGGCATCGCTATGCGCCCATCTCCGGCAGCGTCGAGGC
GGACGACGCCGATGCGCTGACGACGGCTTGGCGAGAGCTCGCTGAGGAGACGGGTCTAGGACCTAGCTCGCTTCG
TCTGCTGCGCCAGGGCAAGCCTTACTCGTTCGTCGACGAGGCTGTTGGCCGCGAGTGGACTATCAATCCCTTTGC
TTTCGCTCTGCGCACAGATGGGCCCGGCGAGGCTGCTATCAAACTCGATCGCGAGCATGAGAGCTTCGCCTGGTT
CGACCCGGCCGAAATTCCTGAAGACGACAACGATGGCGGCGACATAGACGCTACCTCTTCGTCCTTTCGCGGCGT
CCCGCATCTCCTCGACAGCCTGCGCCGCGTCTGGTTTGAGCTCGAGCTCCGTCCCGCCGCCGCCGCTGCCGTCCT
CGACGACGGCTTGCGCCGTCTGCGCGACGATCACACCAGCGGTGCTCGACAGCTGGCTTCGGTCGCCCTCGATAC
CTTGATCCGTGTCTTGCCCGTTCTCCATCGTCCGCCCAATGACTCGGCTCGCTGGTGGCGCAGCCTGCGTATCGC
CGCCTGGCACCTGTGGAAAAACGGCCGCGAAGCCATGGGCGCCTCTATTCTTCGCCTGCTTCTCGATGCCCTGAC
CCTCGTCGAGACGAAATTACCCCCTGATGGCACAGACAGTCTACCTGACGGCTTCATCGACAACGTCCTCGACGC
CTTACAGGGAATCGCTCAGCGGCGGCTCGAATCCGGCGCGGCGCTCCAAGAAGCCTTCGCCTCCTTCGTCCGTCG
TGACCAGGCCACCCGCGCCGACACCTCGCCTATCCGTATCATCAGCCTCTCATCCAGCGCGACCGTCGCCTCGTG
CCTCGACCGCGCCCTCGCCCAGGGACTCGCTCTCGACGTGCACGTGCTCGAGTCCCGCCCGCTCTTCGAGGGCGC
CTCCATGGCCCGCGCCATCGCCGCCTCCATACGCGCCGCGGGGAACCTCCCGGGGGCCAGCGTCTCCGTTCATAC
CGATGCCAGTGTCGCCCTCGCCGCCCGCGGCGCCAACATTCTCCTCCTTGGTGCCGACCTTATCGACGCGAGCGG
CAACGTCAGCAACAAGACGGGCTCGCTGCCTGCCGTCCTCGCTGTTCGTCACGTCGCCCCTGCCGTCAAGGTTGT
TGTCGTCGCCGAGAGCGAAAAGGTACTGCCTCTCGACTCTCCCTCGGCATCTGAGGACAATAACCCGGACCAAGT
CTCGCGCGCCTGGGCAGACGATGACCGTGCAGCCACTCAGGCGGGTAATGTCCACCTCTCCAACGTCTACTTCGA
GTGGGTGCCGGCCGGCCTCATCGACTCCTACATCACCGAGGCTGGCGTCGCGACGGGGGAGGATATCGCTGGCTT
GGCGCGAGACGCTCGGGCGCGGCTGGACCGTTTCTTCTCCAATTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail