Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1456
Gene name
Locationscaffold_150:19361..20985
Strand+
Gene length (bp)1624
Transcript length (bp)1554
Coding sequence length (bp)1551
Protein length (aa) 517

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01008 IF-2B Initiation factor 2 subunit family 3.4E-19 311 495
PF00293 NUDIX NUDIX domain 7.4E-11 16 136

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O58185|EI2BL_PYRHO Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 315 494 1.0E-09
sp|Q7UF90|MTNA_RHOBA Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 335 500 1.0E-08
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 315 493 1.0E-07
sp|A4ILL1|MTNA_GEOTN Methylthioribose-1-phosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnA PE=3 SV=1 314 497 2.0E-07
sp|A4VLZ8|MTNA_PSEU5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 287 493 2.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O58185|EI2BL_PYRHO Putative translation initiation factor eIF-2B subunit 2-like OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0440 PE=1 SV=1 315 494 1.0E-09
sp|Q7UF90|MTNA_RHOBA Methylthioribose-1-phosphate isomerase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=mtnA PE=3 SV=1 335 500 1.0E-08
sp|O57947|R15PI_PYRHO Ribose 1,5-bisphosphate isomerase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=PH0208 PE=3 SV=1 315 493 1.0E-07
sp|A4ILL1|MTNA_GEOTN Methylthioribose-1-phosphate isomerase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=mtnA PE=3 SV=1 314 497 2.0E-07
sp|A4VLZ8|MTNA_PSEU5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas stutzeri (strain A1501) GN=mtnA PE=3 SV=2 287 493 2.0E-07
sp|Q4K8M6|MTNA_PSEF5 Methylthioribose-1-phosphate isomerase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=mtnA PE=3 SV=1 287 504 3.0E-07
sp|Q9V281|R15PI_PYRAB Ribose 1,5-bisphosphate isomerase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB01930 PE=3 SV=1 315 493 4.0E-07
sp|B1J5G5|MTNA_PSEPW Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain W619) GN=mtnA PE=3 SV=1 334 510 6.0E-07
sp|A4XTE5|MTNA_PSEMY Methylthioribose-1-phosphate isomerase OS=Pseudomonas mendocina (strain ymp) GN=mtnA PE=3 SV=1 334 504 8.0E-07
sp|A7GS56|MTNA_BACCN Methylthioribose-1-phosphate isomerase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=mtnA PE=3 SV=1 314 497 1.0E-06
sp|A6V2Q6|MTNA_PSEA7 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain PA7) GN=mtnA PE=3 SV=1 287 493 1.0E-06
sp|C5D7U5|MTNA_GEOSW Methylthioribose-1-phosphate isomerase OS=Geobacillus sp. (strain WCH70) GN=mtnA PE=3 SV=1 314 507 3.0E-06
sp|A6LE92|MTNA_PARD8 Methylthioribose-1-phosphate isomerase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=mtnA PE=3 SV=2 334 493 4.0E-06
sp|A5W7G2|MTNA_PSEP1 Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=mtnA PE=3 SV=1 334 504 4.0E-06
sp|Q48FM6|MTNA_PSE14 Methylthioribose-1-phosphate isomerase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=mtnA PE=3 SV=1 287 504 5.0E-06
sp|Q8KBH1|MTNA_CHLTE Methylthioribose-1-phosphate isomerase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=mtnA PE=3 SV=1 299 504 5.0E-06
sp|Q99LC8|EI2BA_MOUSE Translation initiation factor eIF-2B subunit alpha OS=Mus musculus GN=Eif2b1 PE=1 SV=1 314 495 6.0E-06
sp|B0KTX5|MTNA_PSEPG Methylthioribose-1-phosphate isomerase OS=Pseudomonas putida (strain GB-1) GN=mtnA PE=3 SV=1 334 504 8.0E-06
sp|Q885T7|MTNA_PSESM Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=mtnA PE=3 SV=1 287 504 8.0E-06
sp|Q9HZ65|MTNA_PSEAE Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=mtnA PE=3 SV=1 287 493 9.0E-06
sp|Q02PX5|MTNA_PSEAB Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=mtnA PE=3 SV=1 287 493 9.0E-06
sp|B7V9J7|MTNA_PSEA8 Methylthioribose-1-phosphate isomerase OS=Pseudomonas aeruginosa (strain LESB58) GN=mtnA PE=3 SV=1 287 493 9.0E-06
sp|Q4ZQ92|MTNA_PSEU2 Methylthioribose-1-phosphate isomerase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=mtnA PE=3 SV=2 287 504 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0044237 cellular metabolic process Yes
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm|Nucleus Nuclear export signal 0.7587 0.5834 0.0273 0.0883 0.0767 0.2229 0.0564 0.0462 0.0265 0.0067

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup326
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1633
Ophiocordyceps australis map64 (Brazil) OphauB2|5374
Ophiocordyceps australis map64 (Brazil) OphauB2|5375
Ophiocordyceps camponoti-floridani Ophcf2|01326
Ophiocordyceps camponoti-floridani Ophcf2|01327
Ophiocordyceps camponoti-rufipedis Ophun1|6953
Ophiocordyceps kimflemingae Ophio5|1455
Ophiocordyceps kimflemingae Ophio5|1456 (this protein)
Ophiocordyceps subramaniannii Hirsu2|329
Ophiocordyceps subramaniannii Hirsu2|5054

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1456
MATVPEKRAVAGSFIFRLSPEGRRPQVALFRRSAEVRTYRHRYAPISGSVEADDADALTTAWRELAEETGLGPSS
LRLLRQGKPYSFVDEAVGREWTINPFAFALRTDGPGEAAIKLDREHESFAWFDPAEIPEDDNDGGDIDATSSSFR
GVPHLLDSLRRVWFELELRPAAAAAVLDDGLRRLRDDHTSGARQLASVALDTLIRVLPVLHRPPNDSARWWRSLR
IAAWHLWKNGREAMGASILRLLLDALTLVETKLPPDGTDSLPDGFIDNVLDALQGIAQRRLESGAALQEAFASFV
RRDQATRADTSPIRIISLSSSATVASCLDRALAQGLALDVHVLESRPLFEGASMARAIAASIRAAGNLPGASVSV
HTDASVALAARGANILLLGADLIDASGNVSNKTGSLPAVLAVRHVAPAVKVVVVAESEKVLPLDSPSASEDNNPD
QVSRAWADDDRAATQAGNVHLSNVYFEWVPAGLIDSYITEAGVATGEDIAGLARDARARLDRFFSNL
Coding >Ophio5|1456
ATGGCCACGGTGCCCGAGAAGCGCGCCGTAGCCGGCAGCTTCATCTTTCGACTCAGCCCCGAGGGCCGACGGCCT
CAGGTGGCGTTGTTTCGGAGGAGCGCCGAGGTAAGGACGTACCGGCATCGCTATGCGCCCATCTCCGGCAGCGTC
GAGGCGGACGACGCCGATGCGCTGACGACGGCTTGGCGAGAGCTCGCTGAGGAGACGGGTCTAGGACCTAGCTCG
CTTCGTCTGCTGCGCCAGGGCAAGCCTTACTCGTTCGTCGACGAGGCTGTTGGCCGCGAGTGGACTATCAATCCC
TTTGCTTTCGCTCTGCGCACAGATGGGCCCGGCGAGGCTGCTATCAAACTCGATCGCGAGCATGAGAGCTTCGCC
TGGTTCGACCCGGCCGAAATTCCTGAAGACGACAACGATGGCGGCGACATAGACGCTACCTCTTCGTCCTTTCGC
GGCGTCCCGCATCTCCTCGACAGCCTGCGCCGCGTCTGGTTTGAGCTCGAGCTCCGTCCCGCCGCCGCCGCTGCC
GTCCTCGACGACGGCTTGCGCCGTCTGCGCGACGATCACACCAGCGGTGCTCGACAGCTGGCTTCGGTCGCCCTC
GATACCTTGATCCGTGTCTTGCCCGTTCTCCATCGTCCGCCCAATGACTCGGCTCGCTGGTGGCGCAGCCTGCGT
ATCGCCGCCTGGCACCTGTGGAAAAACGGCCGCGAAGCCATGGGCGCCTCTATTCTTCGCCTGCTTCTCGATGCC
CTGACCCTCGTCGAGACGAAATTACCCCCTGATGGCACAGACAGTCTACCTGACGGCTTCATCGACAACGTCCTC
GACGCCTTACAGGGAATCGCTCAGCGGCGGCTCGAATCCGGCGCGGCGCTCCAAGAAGCCTTCGCCTCCTTCGTC
CGTCGTGACCAGGCCACCCGCGCCGACACCTCGCCTATCCGTATCATCAGCCTCTCATCCAGCGCGACCGTCGCC
TCGTGCCTCGACCGCGCCCTCGCCCAGGGACTCGCTCTCGACGTGCACGTGCTCGAGTCCCGCCCGCTCTTCGAG
GGCGCCTCCATGGCCCGCGCCATCGCCGCCTCCATACGCGCCGCGGGGAACCTCCCGGGGGCCAGCGTCTCCGTT
CATACCGATGCCAGTGTCGCCCTCGCCGCCCGCGGCGCCAACATTCTCCTCCTTGGTGCCGACCTTATCGACGCG
AGCGGCAACGTCAGCAACAAGACGGGCTCGCTGCCTGCCGTCCTCGCTGTTCGTCACGTCGCCCCTGCCGTCAAG
GTTGTTGTCGTCGCCGAGAGCGAAAAGGTACTGCCTCTCGACTCTCCCTCGGCATCTGAGGACAATAACCCGGAC
CAAGTCTCGCGCGCCTGGGCAGACGATGACCGTGCAGCCACTCAGGCGGGTAATGTCCACCTCTCCAACGTCTAC
TTCGAGTGGGTGCCGGCCGGCCTCATCGACTCCTACATCACCGAGGCTGGCGTCGCGACGGGGGAGGATATCGCT
GGCTTGGCGCGAGACGCTCGGGCGCGGCTGGACCGTTTCTTCTCCAATTTG
Transcript >Ophio5|1456
ATGGCCACGGTGCCCGAGAAGCGCGCCGTAGCCGGCAGCTTCATCTTTCGACTCAGCCCCGAGGGCCGACGGCCT
CAGGTGGCGTTGTTTCGGAGGAGCGCCGAGGTAAGGACGTACCGGCATCGCTATGCGCCCATCTCCGGCAGCGTC
GAGGCGGACGACGCCGATGCGCTGACGACGGCTTGGCGAGAGCTCGCTGAGGAGACGGGTCTAGGACCTAGCTCG
CTTCGTCTGCTGCGCCAGGGCAAGCCTTACTCGTTCGTCGACGAGGCTGTTGGCCGCGAGTGGACTATCAATCCC
TTTGCTTTCGCTCTGCGCACAGATGGGCCCGGCGAGGCTGCTATCAAACTCGATCGCGAGCATGAGAGCTTCGCC
TGGTTCGACCCGGCCGAAATTCCTGAAGACGACAACGATGGCGGCGACATAGACGCTACCTCTTCGTCCTTTCGC
GGCGTCCCGCATCTCCTCGACAGCCTGCGCCGCGTCTGGTTTGAGCTCGAGCTCCGTCCCGCCGCCGCCGCTGCC
GTCCTCGACGACGGCTTGCGCCGTCTGCGCGACGATCACACCAGCGGTGCTCGACAGCTGGCTTCGGTCGCCCTC
GATACCTTGATCCGTGTCTTGCCCGTTCTCCATCGTCCGCCCAATGACTCGGCTCGCTGGTGGCGCAGCCTGCGT
ATCGCCGCCTGGCACCTGTGGAAAAACGGCCGCGAAGCCATGGGCGCCTCTATTCTTCGCCTGCTTCTCGATGCC
CTGACCCTCGTCGAGACGAAATTACCCCCTGATGGCACAGACAGTCTACCTGACGGCTTCATCGACAACGTCCTC
GACGCCTTACAGGGAATCGCTCAGCGGCGGCTCGAATCCGGCGCGGCGCTCCAAGAAGCCTTCGCCTCCTTCGTC
CGTCGTGACCAGGCCACCCGCGCCGACACCTCGCCTATCCGTATCATCAGCCTCTCATCCAGCGCGACCGTCGCC
TCGTGCCTCGACCGCGCCCTCGCCCAGGGACTCGCTCTCGACGTGCACGTGCTCGAGTCCCGCCCGCTCTTCGAG
GGCGCCTCCATGGCCCGCGCCATCGCCGCCTCCATACGCGCCGCGGGGAACCTCCCGGGGGCCAGCGTCTCCGTT
CATACCGATGCCAGTGTCGCCCTCGCCGCCCGCGGCGCCAACATTCTCCTCCTTGGTGCCGACCTTATCGACGCG
AGCGGCAACGTCAGCAACAAGACGGGCTCGCTGCCTGCCGTCCTCGCTGTTCGTCACGTCGCCCCTGCCGTCAAG
GTTGTTGTCGTCGCCGAGAGCGAAAAGGTACTGCCTCTCGACTCTCCCTCGGCATCTGAGGACAATAACCCGGAC
CAAGTCTCGCGCGCCTGGGCAGACGATGACCGTGCAGCCACTCAGGCGGGTAATGTCCACCTCTCCAACGTCTAC
TTCGAGTGGGTGCCGGCCGGCCTCATCGACTCCTACATCACCGAGGCTGGCGTCGCGACGGGGGAGGATATCGCT
GGCTTGGCGCGAGACGCTCGGGCGCGGCTGGACCGTTTCTTCTCCAATTTGTGA
Gene >Ophio5|1456
ATGGCCACGGTGCCCGAGAAGCGCGCCGTAGCCGGCAGCTTCATCTTTCGACTCAGCCCCGAGGGCCGACGGCCT
CAGGTGGCGTTGTTTCGGAGGAGCGCCGAGGTAAGGACGTACCGGTAGGTCCCTTGTCGTCCGCATGCGTCCTGG
CCGAGCTCAGCTGGGAGCGTAAATCGTCTCGAGTTTCAGGCATCGCTATGCGCCCATCTCCGGCAGCGTCGAGGC
GGACGACGCCGATGCGCTGACGACGGCTTGGCGAGAGCTCGCTGAGGAGACGGGTCTAGGACCTAGCTCGCTTCG
TCTGCTGCGCCAGGGCAAGCCTTACTCGTTCGTCGACGAGGCTGTTGGCCGCGAGTGGACTATCAATCCCTTTGC
TTTCGCTCTGCGCACAGATGGGCCCGGCGAGGCTGCTATCAAACTCGATCGCGAGCATGAGAGCTTCGCCTGGTT
CGACCCGGCCGAAATTCCTGAAGACGACAACGATGGCGGCGACATAGACGCTACCTCTTCGTCCTTTCGCGGCGT
CCCGCATCTCCTCGACAGCCTGCGCCGCGTCTGGTTTGAGCTCGAGCTCCGTCCCGCCGCCGCCGCTGCCGTCCT
CGACGACGGCTTGCGCCGTCTGCGCGACGATCACACCAGCGGTGCTCGACAGCTGGCTTCGGTCGCCCTCGATAC
CTTGATCCGTGTCTTGCCCGTTCTCCATCGTCCGCCCAATGACTCGGCTCGCTGGTGGCGCAGCCTGCGTATCGC
CGCCTGGCACCTGTGGAAAAACGGCCGCGAAGCCATGGGCGCCTCTATTCTTCGCCTGCTTCTCGATGCCCTGAC
CCTCGTCGAGACGAAATTACCCCCTGATGGCACAGACAGTCTACCTGACGGCTTCATCGACAACGTCCTCGACGC
CTTACAGGGAATCGCTCAGCGGCGGCTCGAATCCGGCGCGGCGCTCCAAGAAGCCTTCGCCTCCTTCGTCCGTCG
TGACCAGGCCACCCGCGCCGACACCTCGCCTATCCGTATCATCAGCCTCTCATCCAGCGCGACCGTCGCCTCGTG
CCTCGACCGCGCCCTCGCCCAGGGACTCGCTCTCGACGTGCACGTGCTCGAGTCCCGCCCGCTCTTCGAGGGCGC
CTCCATGGCCCGCGCCATCGCCGCCTCCATACGCGCCGCGGGGAACCTCCCGGGGGCCAGCGTCTCCGTTCATAC
CGATGCCAGTGTCGCCCTCGCCGCCCGCGGCGCCAACATTCTCCTCCTTGGTGCCGACCTTATCGACGCGAGCGG
CAACGTCAGCAACAAGACGGGCTCGCTGCCTGCCGTCCTCGCTGTTCGTCACGTCGCCCCTGCCGTCAAGGTTGT
TGTCGTCGCCGAGAGCGAAAAGGTACTGCCTCTCGACTCTCCCTCGGCATCTGAGGACAATAACCCGGACCAAGT
CTCGCGCGCCTGGGCAGACGATGACCGTGCAGCCACTCAGGCGGGTAATGTCCACCTCTCCAACGTCTACTTCGA
GTGGGTGCCGGCCGGCCTCATCGACTCCTACATCACCGAGGCTGGCGTCGCGACGGGGGAGGATATCGCTGGCTT
GGCGCGAGACGCTCGGGCGCGGCTGGACCGTTTCTTCTCCAATTTGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail