Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1454
Gene name
Locationscaffold_150:155..14895
Strand-
Gene length (bp)14740
Transcript length (bp)14427
Coding sequence length (bp)14424
Protein length (aa) 4808

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.6E-68 31 421
PF00501 AMP-binding AMP-binding enzyme 1.6E-73 1028 1421
PF00501 AMP-binding AMP-binding enzyme 3.0E-79 2651 3047
PF00668 Condensation Condensation domain 1.6E-20 737 925
PF00668 Condensation Condensation domain 4.3E-24 1658 1998
PF00668 Condensation Condensation domain 7.7E-33 2205 2617
PF00668 Condensation Condensation domain 1.5E-28 3294 3689
PF00668 Condensation Condensation domain 3.6E-27 3836 4233
PF00668 Condensation Condensation domain 1.1E-08 4475 4688
PF00550 PP-binding Phosphopantetheine attachment site 3.7E-04 536 597
PF00550 PP-binding Phosphopantetheine attachment site 4.0E-08 1555 1617
PF00550 PP-binding Phosphopantetheine attachment site 2.8E-08 2101 2162
PF00550 PP-binding Phosphopantetheine attachment site 8.0E-08 3183 3245
PF00550 PP-binding Phosphopantetheine attachment site 4.4E-09 3732 3793
PF00550 PP-binding Phosphopantetheine attachment site 7.9E-10 4285 4347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2099 4227 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2044 4679 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 45 2061 6.0E-159
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 40 1979 3.0E-152
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 62 2060 5.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2099 4227 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2044 4679 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 45 2061 6.0E-159
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 40 1979 3.0E-152
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 62 2060 5.0E-148
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3 2035 4.0E-142
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 504 2571 1.0E-129
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 42 1804 3.0E-129
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2092 3684 6.0E-127
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 47 2069 2.0E-124
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2083 4140 1.0E-123
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 42 1812 3.0E-123
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 42 2143 2.0E-122
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2062 3639 5.0E-117
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 45 1983 3.0E-114
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 979 2577 3.0E-112
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 22 1695 3.0E-112
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 20 1616 2.0E-111
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 47 2005 8.0E-111
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 45 1726 2.0E-110
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 45 1726 4.0E-110
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 47 1984 4.0E-110
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 43 1835 1.0E-108
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 47 1621 5.0E-108
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 77 1909 7.0E-108
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 42 2104 2.0E-106
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 47 1811 9.0E-106
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 985 3039 4.0E-105
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 29 1984 4.0E-105
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2096 3626 1.0E-104
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 42 1796 2.0E-104
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 77 1615 3.0E-104
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 1619 1.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 15 1818 2.0E-103
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 47 1717 3.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2086 3605 1.0E-102
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 47 1520 4.0E-102
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 47 1984 6.0E-102
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 47 1814 1.0E-101
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1024 2471 7.0E-101
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 1683 1.0E-99
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 77 1526 1.0E-99
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 47 1809 1.0E-97
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2197 3795 4.0E-97
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 45 1622 1.0E-96
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 45 1516 5.0E-96
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1024 2043 2.0E-95
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 77 1968 2.0E-94
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 77 2064 4.0E-94
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2566 3687 8.0E-94
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2644 4126 9.0E-94
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2164 3619 1.0E-89
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2192 3730 2.0E-89
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 636 2080 1.0E-88
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1058 1925 2.0E-88
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2082 3569 3.0E-88
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 40 925 1.0E-84
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2390 3693 1.0E-83
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2203 3622 3.0E-83
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2199 3567 8.0E-83
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2195 3795 8.0E-83
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2190 3572 2.0E-82
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2201 3795 8.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1022 2079 9.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2088 3361 2.0E-81
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2096 3607 4.0E-81
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 737 2064 8.0E-81
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 633 2073 2.0E-80
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2069 3584 8.0E-80
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2081 3622 2.0E-79
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2199 3622 8.0E-79
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 47 928 1.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 633 2045 4.0E-78
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 636 1984 6.0E-78
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 631 1984 7.0E-78
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 737 1984 2.0E-77
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 90 1622 2.0E-76
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2333 3852 6.0E-76
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 754 1982 2.0E-75
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 751 2054 4.0E-75
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2204 3622 1.0E-74
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 631 1983 9.0E-74
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 90 967 1.0E-73
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1056 1988 1.0E-73
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2148 3571 2.0E-73
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2088 3619 4.0E-73
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 46 926 5.0E-73
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2557 3684 9.0E-73
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 635 1984 3.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 754 2051 4.0E-72
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2071 3584 5.0E-72
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2199 3604 5.0E-72
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 634 1983 5.0E-72
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2197 3622 8.0E-72
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2679 3631 2.0E-71
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2096 3358 4.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2066 3622 6.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2234 3687 1.0E-70
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2073 3150 1.0E-70
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2096 3435 2.0E-70
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 635 2059 4.0E-70
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 636 1998 5.0E-70
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 680 1984 6.0E-70
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2202 3636 7.0E-70
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2062 3609 1.0E-69
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2199 3253 1.0E-69
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2578 3568 2.0E-69
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 677 1804 2.0E-69
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2199 3816 2.0E-69
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2062 3609 4.0E-69
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2646 3442 6.0E-69
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1010 1808 2.0E-68
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2199 3444 3.0E-68
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2096 3625 4.0E-68
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2202 3243 6.0E-68
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 752 1983 1.0E-67
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 22 914 4.0E-67
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2096 3604 5.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2047 3648 5.0E-67
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2062 3609 1.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2188 3250 2.0E-66
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2096 3619 2.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 579 1988 3.0E-66
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2096 3619 3.0E-66
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1058 1964 4.0E-66
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2176 3248 4.0E-66
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1058 2007 5.0E-66
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2646 3609 7.0E-66
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2646 3609 7.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 738 2067 7.0E-66
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 43 948 8.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2197 3622 1.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2047 3253 1.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2074 3622 2.0E-65
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1049 2143 2.0E-65
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2096 3622 3.0E-65
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1058 2064 3.0E-65
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 728 1809 6.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1049 1982 8.0E-65
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 21 597 9.0E-65
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2047 3253 1.0E-64
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2197 3619 4.0E-64
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1779 3627 5.0E-64
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 636 1628 7.0E-64
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2096 3622 7.0E-64
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 35 915 8.0E-64
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1024 2061 1.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2103 3216 2.0E-63
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2230 3622 3.0E-63
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2199 3261 3.0E-63
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2646 3609 3.0E-63
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 915 1984 5.0E-63
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2405 3640 5.0E-63
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1056 2099 6.0E-63
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1058 1879 7.0E-63
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1058 1879 8.0E-63
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2117 3389 1.0E-62
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2170 3627 1.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2069 3622 1.0E-62
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 678 1989 2.0E-62
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1056 2099 2.0E-62
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 77 1008 2.0E-62
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2099 3250 2.0E-62
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1058 1984 3.0E-62
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 954 2052 5.0E-62
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 636 1516 7.0E-62
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 756 1988 9.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 966 2143 1.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2646 3571 1.0E-61
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 11 599 2.0E-61
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1028 1980 2.0E-61
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 754 1645 3.0E-61
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1022 2050 3.0E-61
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2097 3262 4.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1028 2064 5.0E-61
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 634 1622 6.0E-61
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2105 3155 7.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2098 3360 1.0E-60
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2096 3622 2.0E-60
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2210 3622 2.0E-60
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2210 3622 2.0E-60
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2300 3622 3.0E-60
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2230 3622 3.0E-60
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 45 947 3.0E-60
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2617 3261 3.0E-60
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 67 994 4.0E-60
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2617 3261 4.0E-60
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 143 1627 5.0E-60
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1024 2066 7.0E-60
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2647 3626 7.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1024 1972 1.0E-59
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2088 3400 2.0E-59
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2646 3622 3.0E-59
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1056 2099 3.0E-59
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1058 2007 4.0E-59
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 737 1626 5.0E-59
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2639 3452 9.0E-59
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2199 3360 1.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2098 3254 1.0E-58
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2646 3624 2.0E-58
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 956 1641 3.0E-58
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 756 1984 4.0E-58
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2102 3217 4.0E-58
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2676 3687 4.0E-58
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2197 3687 4.0E-58
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 12 947 5.0E-58
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2649 3568 6.0E-58
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2676 3687 7.0E-58
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 77 596 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 511 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2031 3251 2.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1058 2007 2.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2228 3305 2.0E-57
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2679 3807 3.0E-57
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2638 3692 3.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 961 1713 6.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2097 3687 1.0E-56
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2240 3223 1.0E-56
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2676 3680 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2646 3484 2.0E-56
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 38 926 2.0E-56
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2093 3353 3.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1028 1983 3.0E-56
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1028 1983 4.0E-56
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2679 3690 5.0E-56
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1053 2035 6.0E-56
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2097 3622 9.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1058 2069 9.0E-56
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 56 804 2.0E-55
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2674 3226 2.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1028 1810 2.0E-55
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1028 1522 3.0E-55
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 47 598 3.0E-55
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2099 3249 4.0E-55
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 45 942 4.0E-55
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 47 776 4.0E-55
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 47 598 5.0E-55
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2644 3252 8.0E-55
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2097 3257 1.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 847 1622 2.0E-54
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 45 916 2.0E-54
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 47 950 2.0E-54
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 45 916 3.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1028 1617 3.0E-54
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 47 950 4.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2120 3222 4.0E-54
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 757 1464 4.0E-54
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2096 3255 5.0E-54
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2646 3681 5.0E-54
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1028 1964 5.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2199 3149 6.0E-54
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 41 599 1.0E-53
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 45 916 1.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2679 3251 3.0E-53
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 47 598 3.0E-53
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2701 3640 6.0E-53
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 737 1849 1.0E-52
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 77 823 1.0E-52
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 47 511 1.0E-52
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 46 599 2.0E-52
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 22 928 2.0E-52
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 22 928 2.0E-52
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 78 986 3.0E-52
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1545 2497 4.0E-52
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 45 939 4.0E-52
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 42 598 5.0E-52
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 13 511 8.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2197 3625 1.0E-51
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 42 926 1.0E-51
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2679 3584 1.0E-51
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1058 2069 1.0E-51
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2244 3352 2.0E-51
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1058 1983 3.0E-51
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 733 1522 3.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2637 3243 3.0E-51
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 41 916 4.0E-51
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2678 3611 4.0E-51
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2590 3226 4.0E-51
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 42 650 5.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2096 3451 9.0E-51
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2646 3810 1.0E-50
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 21 600 2.0E-50
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2676 3627 2.0E-50
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2416 3382 2.0E-50
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2646 3092 2.0E-50
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1058 1616 3.0E-50
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1056 1968 4.0E-50
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 733 1522 4.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 42 598 5.0E-50
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 42 926 5.0E-50
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 31 597 8.0E-50
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 913 1.0E-49
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2666 3358 1.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1036 1622 2.0E-49
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2195 3247 2.0E-49
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 80 608 2.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1056 1798 3.0E-49
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 21 511 3.0E-49
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1056 1964 3.0E-49
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1056 1796 5.0E-49
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 753 1522 5.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 42 511 9.0E-49
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 45 511 1.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 957 1707 2.0E-48
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 957 1707 2.0E-48
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1058 1829 3.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 23 513 5.0E-48
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 45 511 6.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 754 1692 9.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 595 1.0E-47
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1056 1628 2.0E-47
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 22 822 2.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 42 777 5.0E-47
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 45 923 5.0E-47
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 47 511 1.0E-46
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 11 599 2.0E-46
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 45 599 3.0E-46
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 21 511 3.0E-46
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 77 599 5.0E-46
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2096 3250 8.0E-46
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1058 1798 9.0E-46
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 47 776 1.0E-45
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 43 917 1.0E-45
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 43 917 1.0E-45
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 78 598 1.0E-45
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 960 1931 1.0E-45
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 42 915 2.0E-45
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 21 511 5.0E-45
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1054 1522 7.0E-45
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 41 847 8.0E-45
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2122 3074 1.0E-44
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1045 1520 2.0E-44
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 45 511 2.0E-44
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1028 1620 2.0E-44
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2060 3224 3.0E-44
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2060 3224 3.0E-44
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 21 511 3.0E-44
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 42 511 4.0E-44
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2677 3151 7.0E-44
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 42 511 1.0E-43
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2677 3243 3.0E-43
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2677 3151 3.0E-43
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2431 3149 5.0E-43
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2677 3151 5.0E-43
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2677 3151 7.0E-43
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2678 3266 8.0E-43
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 45 512 9.0E-43
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2677 3151 9.0E-43
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2331 3090 1.0E-42
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2678 3243 1.0E-42
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2646 3151 2.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 78 641 4.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 77 456 8.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3725 4715 9.0E-42
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2701 3256 9.0E-42
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 90 590 9.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 90 590 1.0E-41
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 41 592 2.0E-41
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2677 3151 3.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 42 514 5.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 41 592 1.0E-40
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 41 592 2.0E-40
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 21 511 4.0E-40
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 84 778 5.0E-40
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1058 1596 7.0E-40
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 47 513 1.0E-39
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 41 593 3.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 78 600 5.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 78 600 5.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 78 600 5.0E-39
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1056 1620 6.0E-39
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 47 513 9.0E-39
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 47 513 9.0E-39
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 47 513 1.0E-38
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 47 513 1.0E-38
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2646 3150 2.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 75 708 3.0E-38
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 42 573 9.0E-38
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2677 3149 2.0E-37
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2700 3264 3.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2677 3149 1.0E-36
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2701 3248 2.0E-36
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2701 3248 2.0E-36
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2701 3248 2.0E-36
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2717 3151 2.0E-36
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2679 3149 2.0E-36
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2646 3622 3.0E-36
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 47 512 3.0E-36
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2677 3149 3.0E-36
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2670 3569 4.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1028 1619 1.0E-35
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 41 611 2.0E-35
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1023 1520 2.0E-35
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1023 1520 2.0E-35
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1023 1520 2.0E-35
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1023 1520 3.0E-35
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1023 1520 3.0E-35
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1023 1520 3.0E-35
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1027 1520 3.0E-35
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1023 1520 5.0E-35
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1058 1520 6.0E-35
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 8 786 1.0E-34
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2660 3151 1.0E-34
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2660 3151 1.0E-34
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1058 1640 1.0E-34
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1023 1520 1.0E-34
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1023 1520 1.0E-34
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2660 3151 2.0E-34
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 78 594 2.0E-34
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 47 513 3.0E-34
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 47 513 3.0E-34
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 47 513 3.0E-34
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2660 3151 3.0E-34
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2643 3149 3.0E-34
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1058 1633 4.0E-34
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2660 3151 4.0E-34
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2643 3149 4.0E-34
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 90 913 6.0E-34
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2561 3292 6.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 88 513 7.0E-34
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1058 1633 8.0E-34
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 47 513 8.0E-34
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 47 513 9.0E-34
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 47 513 1.0E-33
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 47 513 2.0E-33
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1058 1629 2.0E-33
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 47 513 2.0E-33
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 47 513 2.0E-33
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2643 3149 2.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2679 3149 4.0E-33
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 78 598 8.0E-33
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 47 513 9.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1045 1522 1.0E-32
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1058 1520 2.0E-32
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1058 1520 2.0E-32
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1055 1520 2.0E-32
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1058 1520 5.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2660 3150 7.0E-32
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2717 3149 1.0E-31
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2717 3149 1.0E-31
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 41 455 4.0E-31
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2679 3149 4.0E-31
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2717 3151 4.0E-31
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2717 3151 4.0E-31
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 636 1527 5.0E-31
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2675 3149 5.0E-31
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2717 3151 6.0E-31
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1056 1591 8.0E-31
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1056 1591 8.0E-31
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 533 1408 9.0E-31
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2675 3149 9.0E-31
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 47 514 1.0E-30
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 87 512 2.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1058 1520 2.0E-30
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1092 1522 2.0E-30
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2717 3159 2.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1058 1521 3.0E-30
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1058 1522 3.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1058 1520 3.0E-30
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1465 2023 4.0E-30
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1024 1520 4.0E-30
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1024 1520 4.0E-30
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 45 609 4.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1058 1521 4.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 47 514 4.0E-30
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2702 3152 4.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1058 1521 5.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1058 1521 6.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2717 3149 6.0E-30
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 78 595 8.0E-30
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2717 3149 8.0E-30
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2717 3149 8.0E-30
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2676 3149 9.0E-30
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 78 791 1.0E-29
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 78 791 1.0E-29
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2576 3152 2.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1058 1520 2.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2675 3149 3.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2633 3256 3.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2580 3267 4.0E-29
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2646 3224 5.0E-29
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1053 1520 7.0E-29
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1058 1521 7.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1058 1520 7.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1058 1520 7.0E-29
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1028 1463 1.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1496 1931 2.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1058 1522 2.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 47 511 2.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 47 511 2.0E-28
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 88 511 2.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 88 511 2.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1097 1520 2.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1097 1520 2.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3711 4275 3.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1097 1520 3.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 79 513 3.0E-28
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 47 511 4.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 47 511 4.0E-28
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1077 1620 5.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 79 513 5.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 79 513 5.0E-28
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1028 1620 5.0E-28
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2720 3090 8.0E-28
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 957 1620 1.0E-27
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1028 1635 5.0E-27
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3742 4118 6.0E-27
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 42 777 7.0E-27
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 92 511 7.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2097 3090 8.0E-27
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1058 1522 9.0E-27
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2646 3248 1.0E-26
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 84 517 2.0E-26
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 969 1619 2.0E-26
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 72 513 3.0E-26
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 47 511 3.0E-26
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 92 511 3.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2655 3149 4.0E-26
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1082 1649 7.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3742 4362 4.0E-25
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2701 3226 4.0E-25
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 92 511 4.0E-25
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 46 511 4.0E-25
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2701 3226 5.0E-25
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 47 514 1.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1058 1522 2.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1023 1522 2.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1023 1522 4.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 971 1586 8.0E-24
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 971 1586 9.0E-24
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 971 1586 9.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3091 3689 1.0E-23
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3732 4473 2.0E-23
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1023 1522 2.0E-23
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 31 511 3.0E-23
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 94 443 3.0E-23
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 47 514 4.0E-23
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2096 2513 6.0E-23
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1058 1632 9.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 19 514 1.0E-22
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1058 1522 1.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 79 511 1.0E-22
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3183 3626 2.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3703 4227 2.0E-22
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 102 467 2.0E-22
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 84 511 3.0E-22
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 84 511 3.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2194 3156 6.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1100 1463 6.0E-22
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1058 1464 7.0E-22
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2676 3223 8.0E-22
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2024 2607 3.0E-21
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 47 511 4.0E-21
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3290 3622 5.0E-21
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 955 1620 5.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4257 4803 6.0E-21
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1098 1522 6.0E-21
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 548 914 1.0E-20
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3718 4157 2.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 75 572 2.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3029 3575 3.0E-20
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1577 2009 3.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2703 3221 3.0E-20
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2658 3151 4.0E-20
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1656 2002 1.0E-19
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2649 3149 2.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3710 4163 4.0E-19
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1023 1522 4.0E-19
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1035 1681 5.0E-19
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1355 1980 7.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3264 3622 1.0E-18
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1656 1986 1.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1656 1996 2.0E-18
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 46 446 2.0E-18
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 44 641 3.0E-18
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1031 1526 3.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3753 4151 4.0E-18
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3726 4233 6.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2031 2543 7.0E-18
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3747 4231 7.0E-18
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3726 4233 1.0E-17
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1655 1983 1.0E-17
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3290 3679 2.0E-17
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1 551 3.0E-17
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1651 2034 5.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1656 1984 5.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 76 420 7.0E-17
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2670 3085 7.0E-17
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3710 4115 8.0E-17
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3726 4233 8.0E-17
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 35 511 9.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1656 2154 1.0E-16
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 38 512 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3732 4228 2.0E-16
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3793 4230 2.0E-16
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 363 926 2.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3317 3622 2.0E-16
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1058 1522 2.0E-16
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1174 1521 2.0E-16
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3290 3827 3.0E-16
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 170 573 3.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 487 914 5.0E-16
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1098 1589 5.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1638 1984 6.0E-16
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3291 3622 6.0E-16
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3290 3622 6.0E-16
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2634 3056 8.0E-16
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1656 2001 1.0E-15
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1656 1984 1.0E-15
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 21 513 1.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 33 515 1.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3747 4233 2.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3290 3622 2.0E-15
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3286 3695 2.0E-15
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2676 3150 2.0E-15
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 40 511 2.0E-15
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1021 1522 3.0E-15
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1109 1515 4.0E-15
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3826 4194 6.0E-15
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 35 521 6.0E-15
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3823 4230 7.0E-15
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2982 3622 1.0E-14
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 41 515 1.0E-14
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2662 3060 1.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 532 912 2.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3833 4234 2.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3829 4166 2.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3290 3622 2.0E-14
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3831 4245 2.0E-14
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3830 4152 2.0E-14
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2676 3060 2.0E-14
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 38 518 2.0E-14
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3289 3622 3.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3808 4166 4.0E-14
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1055 1522 4.0E-14
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 1056 1524 4.0E-14
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1058 1521 4.0E-14
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3827 4170 5.0E-14
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2679 3622 5.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2793 3161 5.0E-14
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1177 1541 6.0E-14
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2677 3155 6.0E-14
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2677 3155 6.0E-14
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3289 3622 7.0E-14
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 45 527 7.0E-14
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1058 1521 7.0E-14
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3289 3622 9.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2646 3153 9.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1628 1984 1.0E-13
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1345 1520 1.0E-13
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 2676 3150 1.0E-13
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3289 3622 2.0E-13
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3290 3622 2.0E-13
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 57 518 2.0E-13
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 57 518 2.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1175 1463 2.0E-13
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 41 519 2.0E-13
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1179 1523 2.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3833 4152 3.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3731 4133 3.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1075 2069 3.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 41 514 3.0E-13
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2676 3150 3.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2669 3090 3.0E-13
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3753 4227 4.0E-13
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1654 1983 4.0E-13
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2669 3090 4.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1021 1522 5.0E-13
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2676 3150 5.0E-13
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1576 1970 7.0E-13
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1179 1529 7.0E-13
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1163 1520 8.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 633 926 9.0E-13
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1656 1988 9.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1523 1990 1.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3833 4152 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3290 3657 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1656 1981 1.0E-12
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1677 2093 1.0E-12
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 80 514 1.0E-12
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1177 1524 1.0E-12
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1058 1522 1.0E-12
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 47 526 1.0E-12
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 1171 1524 1.0E-12
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2676 3150 1.0E-12
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2679 3155 1.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3203 3622 2.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1655 2067 2.0E-12
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2676 3150 2.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3342 3609 3.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3289 3605 3.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2626 3057 3.0E-12
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3732 4231 4.0E-12
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 2676 3150 4.0E-12
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 2676 3150 4.0E-12
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 1177 1527 4.0E-12
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3831 4186 5.0E-12
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3840 4197 5.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3745 4150 5.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2669 3151 5.0E-12
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 1081 1526 5.0E-12
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 78 513 5.0E-12
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2676 3150 5.0E-12
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 1179 1525 5.0E-12
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 2676 3150 5.0E-12
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 2676 3150 5.0E-12
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 2676 3060 5.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 47 512 5.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 47 512 5.0E-12
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 77 516 5.0E-12
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2676 3150 5.0E-12
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1058 1522 6.0E-12
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 2676 3150 6.0E-12
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 2676 3150 7.0E-12
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2676 3150 7.0E-12
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2676 3150 7.0E-12
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2676 3150 7.0E-12
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 2676 3150 7.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3831 4175 8.0E-12
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2644 3149 8.0E-12
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2658 3152 8.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 47 512 8.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2096 2501 9.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1172 1520 9.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 628 926 1.0E-11
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3724 4162 1.0E-11
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 739 914 1.0E-11
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1056 1521 1.0E-11
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 77 514 1.0E-11
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1098 1525 1.0E-11
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2676 3150 1.0E-11
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 1179 1525 1.0E-11
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 1056 1522 1.0E-11
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2676 3150 1.0E-11
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 2676 3150 1.0E-11
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1179 1521 2.0E-11
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 2676 3150 2.0E-11
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 2676 3150 2.0E-11
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1175 1527 2.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 47 512 2.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 47 512 2.0E-11
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3907 4329 3.0E-11
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3833 4170 3.0E-11
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 45 506 3.0E-11
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2676 3150 3.0E-11
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2656 3161 3.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2755 3073 3.0E-11
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2677 3150 3.0E-11
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1058 1522 3.0E-11
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2676 3150 3.0E-11
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 745 926 4.0E-11
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3830 4186 4.0E-11
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2096 2492 4.0E-11
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2658 3105 4.0E-11
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1058 1521 4.0E-11
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2676 3150 4.0E-11
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 4286 4515 5.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1705 1964 5.0E-11
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 47 514 5.0E-11
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 1179 1525 5.0E-11
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2676 3150 6.0E-11
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 4286 4515 7.0E-11
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 739 914 7.0E-11
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2676 3150 7.0E-11
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2676 3150 7.0E-11
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 111 512 7.0E-11
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 2676 3060 7.0E-11
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1655 2064 8.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1656 2012 8.0E-11
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 93 512 8.0E-11
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2676 3150 8.0E-11
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2676 3150 8.0E-11
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2676 3150 8.0E-11
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2676 3150 9.0E-11
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3822 4230 1.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1654 1992 1.0E-10
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3739 4118 1.0E-10
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2799 3153 1.0E-10
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2676 3150 1.0E-10
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2676 3150 1.0E-10
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 1179 1526 1.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1179 1525 1.0E-10
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2676 3150 1.0E-10
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2615 3007 1.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1179 1527 1.0E-10
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3745 4329 2.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3833 4168 2.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2801 3159 2.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1179 1527 2.0E-10
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1170 1522 2.0E-10
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1170 1522 2.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2791 3156 2.0E-10
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 143 511 2.0E-10
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1655 2054 3.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2646 3153 3.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 78 506 3.0E-10
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1167 1522 3.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1154 1525 3.0E-10
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 111 513 3.0E-10
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 1168 1527 3.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 510 926 4.0E-10
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 1058 1524 4.0E-10
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 1058 1524 4.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2658 3105 4.0E-10
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 166 519 4.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1085 1521 4.0E-10
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1058 1521 4.0E-10
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3840 4151 5.0E-10
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3833 4170 5.0E-10
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2619 3090 5.0E-10
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 1175 1527 5.0E-10
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 19 514 5.0E-10
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 1175 1527 5.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3745 4339 6.0E-10
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 47 506 6.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2796 3155 7.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4300 4524 8.0E-10
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1179 1525 8.0E-10
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1056 1523 8.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4269 4664 9.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 745 926 9.0E-10
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2673 3067 9.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3183 3608 1.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3745 4262 1.0E-09
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3672 4126 1.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1174 1522 1.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1174 1522 1.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2752 3083 1.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2796 3085 1.0E-09
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3863 4169 2.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3109 3435 2.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3858 4195 2.0E-09
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1058 1521 2.0E-09
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 1032 1522 2.0E-09
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1039 1522 2.0E-09
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2716 3073 2.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 1039 1527 2.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3745 4147 4.0E-09
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 4284 4515 4.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3840 4151 4.0E-09
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1174 1522 4.0E-09
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1174 1522 4.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1058 1515 4.0E-09
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2766 3083 4.0E-09
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 166 519 4.0E-09
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2638 3060 4.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 745 954 5.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3870 4228 5.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 169 513 5.0E-09
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 130 514 5.0E-09
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1056 1527 5.0E-09
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2678 3150 5.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2801 3096 5.0E-09
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 78 457 5.0E-09
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1177 1533 5.0E-09
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 77 513 6.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 77 463 6.0E-09
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 4286 4518 8.0E-09
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 168 512 8.0E-09
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2098 2541 9.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2096 2615 9.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 167 513 9.0E-09
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1058 1521 9.0E-09
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3753 4228 1.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1656 1988 1.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1058 1445 1.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2800 3085 1.0E-08
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2801 3150 1.0E-08
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2658 3150 1.0E-08
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2796 3062 1.0E-08
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3753 4228 2.0E-08
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2782 3056 2.0E-08
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2658 3090 2.0E-08
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1171 1522 2.0E-08
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 46 514 2.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1179 1434 2.0E-08
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1177 1527 2.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2646 3150 2.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2669 3061 2.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 627 973 3.0E-08
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2677 3060 3.0E-08
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2676 3051 3.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 161 513 3.0E-08
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 30 512 3.0E-08
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 168 522 3.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3832 4187 4.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3863 4228 4.0E-08
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 65 452 4.0E-08
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2753 3090 4.0E-08
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2701 3153 4.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2669 3060 4.0E-08
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 169 514 4.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1056 1527 4.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 158 513 5.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2674 3149 5.0E-08
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 91 513 5.0E-08
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1166 1522 5.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3948 4238 6.0E-08
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1146 1514 6.0E-08
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 2672 3051 6.0E-08
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 168 544 6.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4275 4659 7.0E-08
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3863 4150 7.0E-08
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 1039 1540 7.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2201 2597 8.0E-08
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3963 4233 8.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 132 519 9.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2701 3156 9.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1656 1988 1.0E-07
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2068 2471 1.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 738 918 1.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3201 3682 1.0E-07
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 40 519 1.0E-07
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 2698 3160 1.0E-07
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 168 514 1.0E-07
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 1058 1425 1.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 173 511 1.0E-07
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 1156 1522 1.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1058 1527 1.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2674 3058 1.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 627 917 2.0E-07
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3863 4150 2.0E-07
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 4212 4683 2.0E-07
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 2661 3156 2.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2795 3095 2.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2701 3156 2.0E-07
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 163 513 2.0E-07
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 163 543 2.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1172 1520 2.0E-07
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 2801 3156 2.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1653 1948 3.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4296 4679 3.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3833 4166 3.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 30 512 3.0E-07
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1058 1521 3.0E-07
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 47 505 3.0E-07
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1058 1527 3.0E-07
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1177 1527 3.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1173 1434 3.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2096 2362 4.0E-07
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 3753 4232 4.0E-07
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2674 3058 4.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 80 511 4.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 154 705 4.0E-07
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 175 514 4.0E-07
sp|O88561|S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus GN=Slc27a3 PE=1 SV=2 2784 3062 4.0E-07
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2701 3150 5.0E-07
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2701 3150 5.0E-07
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2701 3156 5.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2701 3156 6.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2800 3069 6.0E-07
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 1173 1434 6.0E-07
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3745 4228 7.0E-07
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3815 4165 7.0E-07
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 2800 3071 7.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 47 517 7.0E-07
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 46 522 7.0E-07
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 2658 3061 7.0E-07
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2701 3060 8.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2701 3156 8.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 157 525 8.0E-07
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 47 520 8.0E-07
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2799 3090 8.0E-07
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 80 446 9.0E-07
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2800 3095 1.0E-06
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2701 3153 1.0E-06
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2701 3150 1.0E-06
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 168 519 1.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 73 514 1.0E-06
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2777 3150 1.0E-06
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2701 3156 1.0E-06
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 1334 1535 1.0E-06
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 136 547 1.0E-06
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1058 1463 1.0E-06
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 136 547 1.0E-06
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 41 522 1.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 83 446 2.0E-06
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 65 513 2.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 73 514 2.0E-06
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2701 3156 2.0E-06
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2701 3156 2.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 2644 3069 2.0E-06
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 2793 3061 2.0E-06
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 136 456 2.0E-06
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 136 456 2.0E-06
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2657 3156 2.0E-06
sp|Q9ES38|S27A5_RAT Bile acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a5 PE=1 SV=1 9 489 2.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1058 1521 2.0E-06
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2800 3069 3.0E-06
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 1056 1524 3.0E-06
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 2800 3149 3.0E-06
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 2782 3149 3.0E-06
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2701 3156 4.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2701 3156 4.0E-06
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 1043 1202 4.0E-06
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1175 1532 4.0E-06
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2701 3156 5.0E-06
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 1390 1522 5.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4291 4664 6.0E-06
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 2799 3098 6.0E-06
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 1373 1522 6.0E-06
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 169 513 7.0E-06
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1306 1523 7.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 168 517 7.0E-06
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1176 1522 9.0E-06
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2977 3155 9.0E-06
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 1373 1522 9.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 78 514 9.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 636 914 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 42.42 17.66 67.17
CcL In ants, during behavior modification 23.99 7.19 40.78
CcD In ants, recently dead 6.05 3.28 8.83

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.068608 no
SC16a CcD 0.000286 yes
CcL CcD 0.000286 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1454
MAAQGLSIINPRPTRLLGPSLLHQLIAPPSEHLALDQLGQDGKCSYTYRGLHNAAAAIASLLVDVRSSVARSRTP
FVVPVLIPQSSLLCISLLAVLKAGGAFCPLNLDAPRERIKFILNDVSATVVLVSRSTAHLVPAENHVQVIMVDDI
DNGKTSMPTPDHQEPTPEDVAYVMYTSGSTGTPKGVCIPHDAVTQALLAHDRHIPAFSRFLQFAAPTFDVSVFEV
FFPLFRGSTLVTARRDELLDDLPSVLRKMNVDACELTPTVAASLLRRRQNAPALKLLLTIGEMLTLPVVEEFGGS
ETRPSILWAMYGPTEATIHCTLQAALTSESSTGNIGSPLDTVSCFVVEPRASGHDQSAFKVLPQGEVGELAVGGY
QLARGYLNRPEQTASAFITTPYGQVYLTGDKARVTPDGKLECLGRLTSGQVKLRGQRIETGEVEQSALKTPGCHG
AVAAVVDASLVLFCAVDPGTSEDAIATSCSNWLPGFMVPGEIVLMVEFPRLPSGKIDAQKLKSIYQEQKLAEFSE
HDEMVLAEEEVILHVISSVLERQVSKQMTLAFAGVDSLSAIKLASALRLSGFGMSASDMLKLKTVADLCCHIRKR
PMMKLSNHEVFSVSILADWGHILAQNPGLDLAKRNMDDVIPCTSLQTALLAETARDPQLYCNQLEFQVAPGYTVS
DVADAICQVAAENEVLRSGFVSLRGGYAVVLFRDFGTDDNLRVVPQFDESFSFLHPHDFLKPFRVQICNKEKDAG
LRVLFQVHHAVYDGWSMDLILSDLSALLRRVPLSPRPQFREVLRHHLRDFKDVEDDSAMKFWGEHLTGWNKSSFP
KLAAQSPMSNEVQTRSHTLEILPEQVKRMAGEWAVGVQVLFQASLALLWSGIAGEQDMVLGSVTSGRTIAVDQIE
EIVGPCIASLPFRVDLNNMISVKDLLPSESLYDILIVYQESLESLKKQDWLLTEPRESCYRIQATYHSSFFAPGL
VDCLLQQFDDMTGMLLKSPDMCLRSVRSAMPGLSLHNEAVQPFLGVPDLAAQFEATAAAMPTAAALCFCDSFTSL
GPRTLSTSYEELNRAANQVAHYLCSQLIPIGEVLAVLMSKSPTFYTTVLGVQKAGCAYLPILPQTPEVRVRTILK
QAGVKHCLVDNASLPMFSLEGVRIHDVERVEMQRYSPDNRNIPRTASRLAYVIYTSGTTGVPKGVAVTQENIVSN
ITVLRSIYPKPKTAEPRLLQACSQAFDVSVFEIFFAWHAGMCLCAAPNDILFQDLERFMRLLKISHLSLTPTLAS
LIDAAKVPGVEFLVTAGEPMTLSVLDRWHDRLWQGYGPSETTNICSVKHMARGENIEHLGWALPNTSTFVMRTMA
AETVPVGWVGELCFGGHQVAWGYLNDTRLTKEKFVHHPKYGRIYRSGDLGRMLPDGSLVILGRLDDQIKLRGQRI
AAGEINSIITSTNLATTAVTVSARRRKDAPEQLVSFFVPFEARTEYRTMEISPEVNRHLFASLSSRVPPYMVPSY
LIPVSQIPTTASGKVDWRRLRESFEDLTGHHAEAASSTTQCLDGASDWTVRESILADVIARTTKVPRDEIRRWTP
FAALGVDSITAIDLSRTLGSRLETWVSISSILQNPSVAQLAKSLEMKGRLGDETASQKSDALFTTLSGEVGTALG
RDPGDIEEILPCTPLQEAMLSQGTGSYYNKILLRLRIQADDLKAYWDEMSKRHGILRTCFVTTRRAEHPIAQVVL
RRWRVSWKTYDVHAPSLAGVSDEHLKCLPEPLNSGLPPLSCAFMRYKGSTFFSLICHHAIYDGVAMDNLWREIEA
LANQRSLPPPVPYKPFIQHVVDAPEDVDVFWAEHFRGFRPCRLFRRLAGAQVNQCTHTSSFGVTLMEVQERLRWL
GISLLSACQTAWATLLSAVSESPDIAFGTVVNGRIADMEGLDRLIAPCFNTIAMRVDLASISQNIELARQLQDVN
VQMIPYQFTPLRQIQKIVNCQRRALFDTLLLLQQPLKEMDDSVWTLEEDSGNMDVPLVCEMVPCPNLNSIVLNVH
YDIGIVSRDVTACLADIFIYLFRRLIDMPLASPDDKSTLPEALKLGLVDLVPRRDRPEGKSRRRYEDESWTDTEK
VIRGVFSELSGVPQTRIGRDTSIFQLGLDSINAVQVASMLRQKEYRVSASEVIECASCANLACRLLYAFEEKLPE
TTQAISLHKFADDVSSQVLNAMSSDNQFEAVLPATPMQSAMLASFLSSKGHKYLNMLAMEMDDNIGVESLHGAFA
VLQRQHPMLRTGFVSVRHKESSFAMVRHEEAFGGLPVESIHLERFQTFDLCEWQEVTRRDMLKLLHLPLWKAVLV
KQGDRLTLHLTMHHALYDAHSLDELLRSLSSLLLDGREPKFSRVEPALLEVLARGRQGQAAAQEFWEKHAGNAVV
NKFPLLTPLREETTGLSTRETSSSMSSSFLFNAAKDCGSSIQALVQAAWTRVLASYHGESSVVFGITMSGRITDH
GRAAPFPCIVTIPVVARNMESNRQLVEAMMEYNAEMHKHQFTPLSRIQKWLGHPATSVFDTLVVYQKRDGPKTAR
PPWRLVKDEAVVDYAVSLEVEPNAEDDDKLCLRLTFARNLIPEEQAHLIVQQFDATLHHLASEPTGNEDGLYRKR
PDLFAVTPASMPDMPAPVQFLHEFVEYSCRTWPETTALEFVDDWDRKSGTKRWSYRELDLMGNRVAHQLREHTLP
GDVVALHFQKCAEAYFSILGVLKAGCAFVALDPHAPKARKNFILNDSRARCLLAEDGVVIDVDVPIKVLGIAEET
LRKLSYERPSWVGSSLTPAHTCYCLYTSGTTGTPKGCEISHENAVQAMMAFQDLFQGHWDADSRWLQFAALHFDV
SMLEQYWSWAVGITVVSAPRDLILDDLAGAVRRLGITHVDLTPSLARLTSPEEMPSLRVFITGGEQLKQEILDKW
GPKAVIYNAYGPTEATIGVTMCPRVPVNGRPSNIGKQFLNVGSYVFRPLTETPVLRGAVGELCVSGKLVGKGYLR
RPELTKERFPTLVEFGERVYRTGDLVRILHDGCFEFLGRADDQIKLRGQRLEMGEINHAIRSGAAGVLDCATLLV
HRETPDKDVLVSFVVGRASTGRQRLSTLQDPDGLGAQARTACLGRLPAYMVPTYFLRLPYIPLSPNNKVEAKELK
SLFQSLSHEELMKLSAAAVALPTSLDEAGTGSIISIVSEFSGVAEDKFTPSTSLFDVGVDSITALQLTARLRERG
FRAASPAVLLKWPIIAHLVKALADNSSEVASIMVSGVREAKQLLQACHYRYLPFVCRELDVGPDEVEYIAPCSPL
QQGIIFKALSNESSDPYFSSFELRLDRGASVDRVRDAWSRTVDAHAILRSVFVNTPDGHIQVAMRQTKGQWQDVK
FESQDELFLTMETKRRDWVAKNRHHFGRPIELIHAQGPDSQRLFLHIFHALYDGSSLRLISHYAKALYRDEQPPS
SPPFIEALSHGPLSRHDQCRQFWTEHMRGWTPSPVPTLAASSDELRGVTVSRNVPLALLEGLRRQQNVTMQSVVL
ALWTSVLQRCLTSSVTVGVILSGRSIDLAGVERTIGPLFNTVPFFVDALRERTWSSLIREAHGFSTSVMPFQHVP
LKDIQSWCSGGRPLFDNLFVFQLEQPEWCDEAALWEVEDGPDRPDYPLALEATRTLGGNLRLCLVSQSRYADAVM
LEGMLDQFEQVMATAEAEATGSPWQGATEPNQGVLVGNSGEEEAEVMFDWTEEAVVVRNELALLARIPPEQVGAT
TMLLELGLDSIDAMKLSTRLKQRGINVSASNILRSQTIARLVGQLEMSGVALPSNSESSKLLEEIRSRLWIEVEN
GVTDAKMVESVLPPTPLQEAMVSGMVQSGFQWYFNHDILEVADWVDMERLGAAWRQLIEASPCLRSGFIEVGDSN
LDVSYCQVTFKSRTCCVKTRALADKSEMGQVMLDATRLAAQSKGLQDLVQIALVTVGERRLVVVSMAHALYDGWS
LGLMYRDLEELYWGRERKTQQTSTDAFVGRVLACRTEEARGFWTGHLAGLRPTLLTGRAKTTTKTGDWPLRKEAP
SGCSLSQLTSFCKRQAISLQVLCVATWAVVVAERTRGLDVVFGLVLSGRDGEGTEELMLPTMSTVALRCVLHGSV
SSFLKYVEETVTDVRGYQHYPLRRVQAAEAFNSLFLFQKTPRQNEASTRLFRSIDGQSAVEYPVCVEAEPVDDGL
VWRVACHRQLFSSQDTQLLLSRLDQVLQYMFDHEAIAVLSFEDEGVSICGLPVLEVEEGRVLDCRPDVTDDQPSE
QETWGDTATAIRHVLSQVSDMPVESITLRSSLYQLGLDSISAVKVSMLLRKRGIELKPRQLVKLSSLREMADNVT
LAGQDTKKQKSHPGVTWKPPRSMDVDELLRECNVPRDCVEAVLPATPMQAYMLTAWEKPGGAVFFPEFHYRMDGT
DDVLRAQEAWKMLSDQTAVLRTRFLATGFDEVPWIQAVMHKEAIRSGRISQPLVRLDINKADSGKGLELRLKIHH
ALYDELSLAALTSQLCELVNSTAAPESDDDDDDDDDDDDGFSRWALYCNALPDGRARRREFWTEYLRGGTAVDIE
ASSATDTAERASYLDKSAVNDVTDLRATASQHSISLQALVLAALAKSLAGRDSERAIILGIYLANRAGGERDSPP
ATCPTLNLVPVKVQPSPGLRLVDMARAIQADVVSIGDDGRAQVGLWEILAWTGVRIGCFVNFLVGGAKVDRVGDV
VTLRSVQGDVMPIMVMGEASPRGPRRNVVSDAVEPSVDIEASVSGDKALAVGVFGPRGRVTDEWAAKLVADTVAF
LAEAGAGG
Coding >Ophio5|1454
ATGGCCGCCCAAGGCTTGTCCATCATCAATCCGCGTCCAACCAGGTTGTTGGGTCCAAGCTTGCTTCATCAGCTA
ATCGCTCCGCCTTCCGAACACTTAGCTCTTGATCAGCTGGGCCAGGACGGGAAATGTTCATACACGTATCGAGGC
TTGCACAACGCCGCTGCAGCCATCGCCAGTCTCCTCGTTGACGTCCGTTCATCGGTTGCACGGAGCCGCACTCCA
TTCGTCGTCCCTGTACTCATCCCGCAGTCGTCCTTACTTTGCATCTCTCTGCTCGCCGTTCTCAAAGCTGGCGGT
GCCTTTTGTCCTCTCAACCTCGATGCCCCTCGTGAGAGAATCAAGTTTATTCTTAACGATGTCTCCGCCACTGTC
GTCCTCGTCTCACGCTCCACGGCGCATTTGGTGCCCGCGGAAAACCATGTACAAGTTATAATGGTGGATGACATC
GACAATGGGAAAACTTCCATGCCAACTCCTGATCATCAGGAGCCTACTCCAGAGGACGTGGCCTATGTCATGTAC
ACGTCTGGATCGACCGGGACGCCCAAAGGCGTATGTATCCCTCATGATGCCGTAACGCAAGCCCTCCTTGCCCAC
GACCGTCACATACCGGCCTTTTCCAGGTTTCTGCAATTCGCCGCACCTACGTTCGACGTCTCAGTCTTCGAAGTC
TTCTTCCCCCTTTTTCGCGGTAGCACCCTGGTCACTGCCCGCCGCGATGAGCTGCTGGATGACCTGCCATCGGTT
CTTCGGAAGATGAACGTCGATGCCTGCGAGTTGACGCCCACAGTCGCTGCGAGCCTGCTCAGAAGACGCCAGAAT
GCGCCCGCTCTCAAGCTTCTCCTGACCATAGGCGAGATGCTGACCCTCCCCGTCGTCGAGGAGTTTGGCGGGTCT
GAAACAAGGCCCAGCATCCTCTGGGCCATGTATGGGCCAACAGAAGCAACCATTCATTGCACGCTGCAGGCCGCC
TTGACGTCTGAGTCATCAACAGGGAACATTGGAAGCCCCCTTGATACAGTTTCCTGCTTCGTCGTTGAGCCTCGG
GCCTCTGGCCATGACCAAAGCGCCTTCAAAGTTCTCCCGCAGGGCGAAGTCGGTGAATTGGCCGTCGGCGGCTAC
CAGTTGGCCCGCGGTTATCTAAACCGCCCAGAACAAACAGCTTCTGCTTTCATCACCACTCCTTACGGTCAGGTT
TACCTTACGGGAGACAAGGCTCGCGTGACGCCTGATGGAAAGCTCGAATGTCTCGGTCGCTTGACGAGCGGGCAG
GTGAAGCTGCGTGGCCAGCGCATCGAGACTGGTGAGGTGGAACAGTCGGCTCTGAAGACACCAGGCTGCCATGGC
GCTGTAGCAGCCGTCGTTGACGCCAGTTTGGTCCTATTCTGCGCCGTCGATCCAGGCACTTCTGAGGATGCCATT
GCCACGAGCTGCAGCAACTGGTTGCCCGGCTTCATGGTCCCAGGGGAGATTGTCTTGATGGTTGAGTTTCCTCGC
TTGCCAAGTGGAAAGATCGATGCACAGAAGCTCAAGTCAATCTATCAGGAGCAGAAGTTGGCCGAATTTTCTGAG
CACGACGAGATGGTGCTCGCTGAGGAGGAAGTGATTCTTCATGTGATCTCGTCTGTTTTGGAACGACAAGTAAGC
AAGCAGATGACACTGGCCTTTGCCGGCGTAGATTCACTTTCAGCAATCAAGCTGGCGTCTGCGCTGCGACTGTCA
GGCTTCGGGATGAGTGCCTCTGATATGCTGAAACTGAAGACAGTAGCAGACCTTTGCTGTCATATTCGCAAACGA
CCCATGATGAAGCTGTCGAACCATGAAGTTTTCAGTGTAAGCATACTGGCCGACTGGGGCCATATCCTTGCTCAG
AACCCCGGATTGGACCTGGCAAAAAGAAACATGGATGACGTTATCCCCTGCACTTCGCTTCAAACGGCTTTGTTG
GCTGAGACGGCGCGCGATCCCCAGCTCTATTGCAACCAGCTCGAGTTTCAGGTCGCACCAGGATATACAGTCAGC
GACGTTGCGGATGCAATCTGCCAAGTTGCGGCGGAAAACGAAGTCCTCCGCTCAGGCTTCGTTTCGTTGCGTGGT
GGATATGCTGTCGTCTTGTTCAGGGACTTTGGGACCGACGATAACCTCCGCGTCGTGCCACAGTTTGACGAGAGC
TTTTCGTTTCTGCATCCGCACGACTTCCTTAAGCCATTCCGAGTTCAGATCTGCAACAAGGAGAAGGATGCTGGA
CTTCGAGTTCTTTTCCAGGTTCATCACGCCGTCTACGACGGTTGGTCCATGGATCTGATCTTGTCCGACTTGTCC
GCGCTGCTGCGACGTGTTCCGCTCTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGACATCACCTGAGAGACTTC
AAGGACGTCGAAGATGACTCGGCGATGAAGTTTTGGGGCGAGCACCTGACGGGATGGAACAAGTCCTCTTTCCCG
AAGCTGGCGGCTCAATCCCCTATGTCGAATGAGGTTCAGACAAGGAGCCACACGTTGGAGATACTGCCCGAGCAG
GTAAAGCGAATGGCAGGAGAGTGGGCGGTAGGTGTCCAGGTGCTGTTCCAAGCATCTTTGGCTCTGCTATGGAGT
GGCATCGCTGGAGAGCAAGATATGGTGCTTGGGTCCGTGACTTCTGGGCGGACAATAGCCGTGGATCAAATCGAG
GAGATAGTCGGGCCTTGCATTGCGTCTCTGCCTTTCCGAGTCGATCTCAACAACATGATTTCTGTCAAGGACTTA
CTGCCGTCTGAGAGTCTATACGACATTCTCATCGTCTATCAGGAGTCTCTCGAGAGCTTGAAAAAACAAGACTGG
CTCCTTACCGAACCTCGCGAATCATGTTACAGGATCCAGGCCACCTACCACTCTTCGTTCTTTGCGCCTGGTCTA
GTCGACTGCCTCCTCCAACAGTTCGATGACATGACGGGGATGCTGCTGAAGAGTCCCGATATGTGTCTTCGATCT
GTTCGGTCTGCCATGCCCGGGCTGTCGCTCCATAACGAAGCCGTGCAGCCGTTTCTCGGAGTGCCTGACCTTGCT
GCTCAGTTTGAGGCGACGGCGGCCGCCATGCCTACGGCCGCTGCGTTGTGCTTCTGCGACTCGTTCACCTCTCTG
GGTCCCCGGACGCTGTCGACCTCCTATGAAGAGCTGAATAGAGCTGCTAATCAAGTCGCCCATTATCTGTGCAGT
CAGCTGATCCCGATCGGAGAGGTTCTGGCTGTGCTCATGTCAAAATCTCCCACGTTTTACACCACTGTCCTTGGT
GTTCAAAAGGCAGGATGCGCGTACCTGCCCATTCTTCCCCAGACGCCCGAGGTGCGGGTGCGCACCATTCTCAAG
CAGGCTGGAGTCAAGCACTGCCTCGTTGATAATGCCTCTTTACCGATGTTCTCGCTTGAAGGCGTGCGGATTCAC
GACGTGGAGCGCGTCGAGATGCAGCGTTACTCGCCAGATAATCGGAACATCCCACGCACTGCTTCTCGTCTGGCC
TATGTCATCTACACTTCAGGAACTACAGGGGTGCCGAAAGGCGTTGCTGTCACGCAGGAAAACATCGTCAGCAAC
ATCACAGTCTTGCGATCCATCTACCCCAAGCCCAAGACGGCAGAGCCGCGACTGCTCCAGGCCTGCTCCCAAGCG
TTTGACGTGTCTGTTTTTGAGATATTTTTCGCCTGGCACGCGGGCATGTGCCTGTGTGCAGCCCCGAACGACATC
TTATTCCAAGACCTGGAGCGCTTCATGCGCCTGTTGAAGATTAGCCACTTGAGCTTGACGCCGACGTTGGCCTCG
CTCATAGATGCCGCCAAGGTACCAGGTGTCGAGTTTCTCGTCACTGCCGGCGAGCCGATGACGCTGTCCGTTTTG
GATCGATGGCACGACCGGCTTTGGCAAGGATATGGGCCGTCCGAAACGACCAACATATGCAGCGTGAAGCACATG
GCACGCGGAGAAAACATTGAGCATCTTGGCTGGGCTCTGCCCAACACGTCGACGTTTGTCATGCGGACCATGGCC
GCGGAGACTGTCCCCGTCGGATGGGTGGGCGAACTCTGCTTTGGCGGCCATCAGGTCGCGTGGGGATACTTGAAC
GACACTCGTCTGACGAAGGAGAAGTTTGTCCATCACCCCAAATATGGAAGGATTTACCGTTCTGGAGATCTGGGT
CGAATGCTCCCTGATGGCTCGCTGGTGATCCTTGGCCGGCTCGACGATCAGATTAAGCTGCGAGGCCAGCGGATC
GCAGCCGGCGAAATCAACAGTATCATCACTTCCACCAATCTGGCAACCACTGCCGTGACGGTCTCTGCTCGACGG
CGGAAAGACGCACCAGAGCAGCTGGTGTCGTTCTTCGTCCCCTTTGAAGCCCGAACTGAATACCGGACGATGGAG
ATCTCGCCGGAAGTCAACCGCCATCTCTTCGCAAGCTTGTCATCTCGGGTGCCGCCGTACATGGTGCCATCCTAC
TTGATTCCCGTATCTCAAATACCCACGACGGCTAGTGGCAAGGTAGACTGGCGACGCCTTCGAGAGAGTTTTGAG
GACTTGACCGGGCATCACGCCGAGGCTGCCTCTTCCACCACGCAATGTCTCGATGGCGCGAGCGACTGGACTGTA
AGGGAATCGATTCTTGCCGACGTCATCGCGCGTACGACAAAGGTCCCGCGAGATGAGATAAGACGGTGGACGCCG
TTCGCGGCCCTGGGCGTAGATTCCATTACTGCCATTGACTTGTCTCGCACGCTGGGCTCTCGCCTGGAGACCTGG
GTGTCGATATCCTCCATTCTTCAGAACCCGTCCGTTGCTCAGCTGGCCAAGTCGCTGGAGATGAAGGGAAGGCTC
GGTGACGAAACCGCCTCTCAAAAGTCTGACGCTCTGTTTACAACCTTGTCCGGCGAGGTTGGTACCGCCTTGGGC
CGAGACCCGGGAGATATCGAAGAGATCCTTCCGTGCACGCCACTGCAGGAAGCCATGCTTTCGCAAGGGACGGGA
AGCTATTATAACAAGATCCTGCTGCGACTCCGCATCCAGGCCGATGACCTGAAGGCCTACTGGGATGAGATGTCC
AAACGACACGGAATTCTCAGAACCTGTTTCGTCACGACGCGGCGCGCCGAGCATCCGATTGCGCAAGTAGTCCTG
AGGCGATGGAGGGTGTCGTGGAAGACGTATGACGTTCACGCGCCCTCCCTTGCTGGCGTATCCGACGAGCATCTG
AAGTGCCTTCCGGAGCCCCTGAACTCGGGCCTGCCCCCTCTGTCTTGCGCCTTTATGAGATATAAAGGTTCAACT
TTCTTTTCGCTGATCTGCCATCATGCCATTTATGACGGCGTCGCCATGGACAACCTGTGGCGGGAAATCGAAGCC
TTGGCCAACCAGCGCAGCCTTCCCCCCCCTGTGCCCTACAAGCCGTTCATACAGCACGTTGTCGACGCTCCCGAG
GATGTTGATGTGTTCTGGGCCGAGCATTTCCGCGGCTTCCGGCCTTGCAGGCTCTTCAGACGCTTGGCCGGTGCG
CAGGTGAACCAATGTACTCATACCAGCTCTTTTGGCGTGACGTTGATGGAGGTCCAAGAACGCTTAAGATGGCTC
GGAATCTCTCTTCTCTCTGCATGCCAGACGGCGTGGGCAACACTTCTCTCGGCAGTAAGCGAGAGTCCAGATATT
GCCTTTGGTACCGTCGTCAACGGCCGTATCGCCGACATGGAAGGTCTGGACCGGTTGATTGCCCCCTGCTTCAAC
ACTATTGCGATGCGTGTCGACCTTGCAAGCATTTCCCAGAACATCGAATTAGCCAGACAGTTGCAAGATGTCAAC
GTACAGATGATCCCGTATCAGTTCACGCCATTGCGACAGATTCAGAAGATCGTCAACTGTCAACGTCGGGCATTG
TTTGATACCTTGCTGCTCCTTCAGCAACCACTCAAGGAGATGGACGACAGCGTTTGGACACTCGAAGAGGATTCA
GGAAACATGGACGTCCCGCTGGTGTGCGAGATGGTTCCATGTCCAAACCTCAACTCGATCGTCCTCAACGTCCAT
TATGACATCGGAATCGTCTCCAGGGACGTTACTGCATGTCTGGCCGACATCTTCATATACCTTTTCCGTCGTCTG
ATTGACATGCCGCTCGCGAGCCCAGATGATAAGAGCACCTTACCAGAGGCTCTGAAGTTGGGTCTCGTGGATCTC
GTCCCAAGGCGTGACAGGCCAGAGGGTAAAAGCCGCCGGCGATATGAGGACGAGAGCTGGACCGACACCGAGAAG
GTGATTCGGGGAGTCTTCTCGGAGCTTTCTGGTGTGCCGCAGACAAGGATCGGCCGTGATACCAGCATATTCCAG
CTCGGATTGGACAGCATCAACGCTGTTCAGGTCGCTTCGATGCTCCGGCAGAAGGAATATAGGGTTTCTGCGTCG
GAAGTCATCGAGTGCGCCAGCTGTGCGAATTTGGCCTGTCGACTGCTCTACGCCTTCGAAGAGAAGCTGCCGGAG
ACAACGCAGGCGATCAGCCTGCACAAATTCGCCGACGACGTCTCCTCACAAGTACTTAACGCGATGTCGTCTGAT
AACCAATTTGAGGCCGTTCTCCCTGCCACGCCCATGCAGTCGGCCATGCTGGCCTCATTTCTCTCCTCAAAGGGC
CACAAATACCTCAACATGCTGGCAATGGAGATGGACGACAACATTGGCGTGGAAAGCCTGCATGGGGCTTTCGCA
GTCCTCCAGCGGCAGCATCCGATGCTCCGTACTGGCTTCGTTTCTGTGAGACATAAAGAGAGCTCGTTTGCCATG
GTACGACATGAGGAGGCTTTCGGCGGCTTGCCTGTTGAGAGCATCCATCTCGAGCGGTTTCAGACGTTCGACTTG
TGTGAATGGCAAGAGGTCACTCGGCGAGACATGCTGAAGCTTCTACATCTGCCACTTTGGAAAGCGGTCTTGGTC
AAGCAAGGGGATCGGCTGACGCTTCATCTCACCATGCATCATGCTCTCTATGACGCACACTCGCTAGATGAGCTC
CTACGAAGCCTCTCAAGCCTCCTACTCGATGGCAGAGAGCCTAAATTCTCCAGGGTCGAACCAGCTTTGTTGGAG
GTTCTTGCCCGCGGTCGACAAGGGCAGGCGGCTGCTCAAGAGTTCTGGGAGAAGCATGCGGGCAACGCCGTGGTG
AACAAGTTTCCACTTTTGACGCCTTTGAGAGAAGAGACAACGGGTCTGTCAACCCGCGAAACGTCTTCGTCAATG
TCCTCCAGCTTTCTCTTTAACGCCGCCAAGGACTGCGGTAGCTCAATCCAGGCGTTGGTGCAAGCCGCCTGGACA
CGCGTTCTGGCCTCGTATCATGGCGAGAGCTCGGTTGTATTTGGGATCACAATGTCAGGGCGTATCACCGACCAC
GGTCGAGCCGCTCCGTTTCCCTGCATCGTCACCATCCCAGTTGTGGCGCGTAACATGGAGTCAAACAGACAGCTT
GTCGAAGCAATGATGGAGTATAATGCCGAAATGCACAAGCATCAGTTCACCCCGTTGAGTCGGATCCAGAAATGG
TTAGGTCATCCTGCCACTTCCGTCTTCGACACGCTTGTTGTCTATCAAAAGAGAGACGGACCGAAGACGGCACGC
CCGCCTTGGAGGTTGGTCAAGGATGAAGCGGTTGTTGACTACGCCGTCTCTCTCGAGGTCGAGCCGAATGCTGAG
GATGATGATAAACTATGCCTCCGGCTCACCTTTGCCAGAAACCTCATACCGGAGGAACAGGCGCACCTCATCGTT
CAACAGTTCGACGCCACACTGCATCATCTGGCCAGCGAGCCTACCGGGAACGAAGATGGACTCTACAGAAAGCGA
CCTGATCTTTTCGCAGTCACCCCGGCTTCGATGCCAGACATGCCTGCTCCGGTACAATTTCTTCATGAGTTCGTG
GAGTATAGCTGCAGGACTTGGCCAGAAACAACGGCCTTGGAGTTTGTGGACGACTGGGACAGAAAGTCGGGCACG
AAAAGATGGAGCTACAGAGAACTCGATCTGATGGGAAACCGCGTCGCTCATCAGCTGCGAGAGCATACCCTTCCC
GGAGACGTGGTGGCACTTCACTTTCAGAAATGCGCCGAGGCGTATTTTTCGATCCTCGGTGTCCTCAAAGCCGGC
TGTGCATTCGTCGCCCTCGACCCTCATGCTCCGAAGGCAAGGAAGAACTTCATCTTGAATGATTCACGTGCGAGG
TGCCTTTTAGCGGAGGACGGAGTGGTGATAGATGTCGACGTTCCCATCAAAGTGCTGGGAATCGCCGAGGAAACG
CTTCGAAAGCTGTCGTACGAGCGTCCGTCTTGGGTCGGGAGCAGTCTGACGCCTGCCCACACCTGCTATTGTCTT
TACACGTCCGGCACGACGGGGACGCCCAAAGGATGCGAGATCAGTCACGAGAATGCGGTCCAGGCCATGATGGCC
TTTCAAGACCTGTTCCAAGGGCACTGGGACGCCGACTCGCGCTGGCTGCAGTTTGCGGCGCTTCACTTTGACGTC
TCCATGCTCGAGCAGTACTGGAGTTGGGCAGTGGGCATCACGGTCGTGTCCGCGCCCCGAGATCTGATCCTGGAC
GACCTCGCCGGGGCAGTTAGGAGGCTCGGCATCACCCATGTCGACCTCACCCCTAGTCTGGCCCGGCTGACGAGT
CCTGAGGAGATGCCGAGTCTGCGCGTCTTCATCACGGGAGGAGAGCAACTGAAGCAGGAGATTCTCGATAAATGG
GGCCCAAAGGCCGTCATCTACAACGCCTACGGCCCTACGGAGGCGACCATCGGCGTGACCATGTGTCCGCGCGTG
CCCGTCAACGGACGCCCGAGCAACATTGGTAAACAGTTTCTCAATGTCGGCTCTTACGTCTTTCGTCCATTGACC
GAGACTCCTGTCCTACGAGGTGCCGTCGGGGAGCTGTGCGTGTCAGGCAAGCTGGTGGGCAAGGGATACCTGCGC
CGTCCAGAGCTCACCAAGGAGCGGTTCCCGACGCTCGTCGAGTTTGGTGAAAGGGTCTACAGGACGGGCGACCTG
GTGCGGATCCTCCACGACGGATGCTTTGAGTTTCTTGGCCGCGCAGACGATCAGATCAAGTTGCGCGGACAGCGG
CTGGAGATGGGCGAGATTAACCACGCAATCCGCTCAGGGGCGGCGGGCGTTCTCGATTGTGCAACGCTCTTGGTG
CACAGAGAGACTCCGGACAAGGATGTCTTGGTGTCCTTTGTTGTCGGACGGGCGTCAACCGGCCGTCAAAGGCTC
TCCACGTTGCAAGACCCCGACGGACTTGGTGCTCAAGCAAGAACGGCTTGTCTTGGGAGGCTGCCGGCCTACATG
GTGCCAACATATTTCCTCCGGCTGCCGTACATACCTCTCTCGCCGAACAACAAGGTCGAAGCTAAAGAGCTCAAG
TCGTTGTTTCAGTCTCTCTCGCATGAGGAGCTGATGAAGCTGTCGGCCGCTGCTGTGGCTCTCCCGACGAGCCTC
GACGAGGCCGGCACTGGCAGCATCATCAGCATCGTGTCCGAGTTTAGCGGCGTCGCAGAAGACAAGTTCACGCCG
TCGACCAGCCTGTTCGACGTCGGCGTGGACTCCATCACCGCCCTGCAATTGACCGCCCGGCTTCGCGAACGAGGT
TTCCGGGCTGCCTCTCCCGCTGTGTTGCTGAAATGGCCCATCATCGCGCACCTCGTCAAAGCCCTGGCCGACAAC
TCCTCAGAAGTAGCAAGCATCATGGTTAGCGGTGTGAGGGAAGCTAAACAGCTCCTGCAGGCCTGTCACTACAGA
TATCTCCCATTCGTGTGCCGCGAGCTGGACGTGGGGCCTGATGAGGTTGAATATATTGCGCCGTGCTCGCCGCTG
CAACAGGGCATCATCTTCAAAGCTCTCAGTAACGAGAGCTCCGACCCTTACTTTTCCTCTTTCGAGCTGAGACTG
GATAGAGGCGCCTCGGTTGACAGAGTCCGCGACGCCTGGAGTCGGACTGTTGATGCTCACGCCATACTTCGATCT
GTTTTTGTCAACACCCCTGATGGGCATATTCAGGTCGCAATGCGTCAGACAAAGGGTCAATGGCAAGACGTGAAA
TTTGAATCTCAAGACGAACTCTTTCTCACCATGGAAACGAAAAGGCGAGATTGGGTTGCGAAAAACAGGCATCAC
TTTGGCCGCCCCATCGAGCTCATTCACGCGCAGGGGCCGGACTCTCAGAGGCTCTTCCTCCACATCTTCCATGCG
CTCTACGACGGCAGCAGCTTGCGACTCATCAGCCACTATGCCAAGGCCCTGTACCGCGACGAGCAACCGCCGTCA
AGCCCCCCATTTATCGAGGCCTTGAGCCACGGGCCGCTCTCAAGACACGATCAGTGCCGACAGTTTTGGACGGAG
CACATGCGTGGCTGGACACCGTCACCAGTGCCGACGCTCGCAGCATCGTCAGACGAACTCAGAGGCGTGACAGTC
AGTCGCAACGTTCCGCTGGCCCTACTCGAGGGGCTGCGACGTCAACAAAACGTCACGATGCAGTCTGTCGTGCTC
GCCCTGTGGACTTCGGTCCTCCAGAGATGTCTGACCAGCAGCGTCACAGTTGGCGTCATTCTTTCAGGCAGGTCT
ATTGACCTTGCTGGGGTCGAGCGGACAATCGGCCCTCTGTTCAACACCGTGCCCTTCTTCGTCGACGCCCTGCGA
GAGCGCACTTGGTCGTCGTTGATCCGCGAGGCCCATGGCTTCAGCACTTCGGTAATGCCTTTCCAACATGTGCCC
CTGAAGGACATCCAGTCATGGTGCTCTGGAGGCCGTCCGCTTTTCGACAATCTCTTTGTGTTCCAGCTTGAACAG
CCTGAATGGTGCGACGAAGCTGCGCTTTGGGAGGTCGAAGACGGTCCGGATCGCCCCGATTACCCCCTGGCGCTC
GAAGCGACGCGAACATTAGGGGGGAACTTACGGCTATGCCTTGTGTCGCAAAGCCGGTATGCTGATGCAGTCATG
CTGGAGGGCATGCTGGACCAATTCGAACAGGTGATGGCGACAGCCGAGGCGGAGGCAACGGGGAGTCCTTGGCAA
GGCGCTACAGAGCCCAATCAGGGGGTGTTAGTCGGGAACTCTGGAGAGGAAGAGGCGGAGGTCATGTTCGACTGG
ACGGAGGAAGCTGTTGTGGTGAGGAATGAGTTGGCGCTACTTGCCCGCATACCCCCTGAACAAGTCGGCGCAACA
ACTATGCTGCTGGAGCTGGGCCTTGACAGCATTGATGCGATGAAGCTCTCAACAAGGCTGAAGCAGCGTGGAATC
AACGTATCTGCGTCAAACATACTGCGAAGCCAGACGATAGCCCGTCTCGTTGGTCAGCTGGAGATGAGCGGCGTT
GCGCTTCCATCCAACTCTGAGTCTTCGAAACTCCTCGAAGAGATAAGATCTAGGCTCTGGATCGAGGTAGAGAAT
GGTGTGACAGACGCGAAAATGGTTGAGTCGGTCTTGCCTCCGACTCCTCTCCAGGAAGCCATGGTTTCGGGCATG
GTTCAGTCAGGCTTTCAGTGGTACTTCAACCACGATATCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTT
GGTGCCGCGTGGAGGCAGCTGATCGAGGCATCGCCATGCTTGAGAAGCGGCTTCATCGAAGTTGGCGACTCGAAT
CTGGACGTGTCGTACTGCCAAGTCACCTTCAAGAGCAGAACTTGTTGCGTCAAGACGCGGGCGCTGGCGGACAAG
TCTGAGATGGGACAGGTGATGCTGGACGCGACGCGGCTGGCTGCTCAAAGCAAGGGACTGCAAGACTTGGTGCAG
ATTGCGCTGGTGACGGTTGGCGAGCGACGTCTCGTTGTCGTTTCCATGGCTCATGCTCTCTACGACGGTTGGTCG
CTCGGGCTCATGTATCGGGATCTGGAAGAGCTGTACTGGGGGCGGGAGAGGAAGACACAACAAACATCCACCGAT
GCTTTTGTTGGGCGCGTTCTGGCCTGCAGGACGGAAGAGGCCCGCGGTTTCTGGACTGGTCATCTCGCGGGCCTT
CGGCCGACTTTGTTGACAGGAAGGGCGAAGACGACAACGAAAACAGGAGACTGGCCGTTGCGCAAAGAAGCTCCG
TCCGGCTGCAGTCTCTCTCAACTAACAAGCTTCTGCAAGAGGCAGGCAATCAGTCTACAGGTGCTCTGCGTCGCC
ACATGGGCTGTCGTCGTGGCGGAGCGAACCAGGGGCCTCGATGTCGTCTTCGGACTCGTGCTGTCTGGCAGAGAC
GGAGAGGGGACGGAGGAGCTGATGTTGCCGACCATGAGCACAGTGGCCTTGCGCTGCGTCCTTCACGGCTCCGTC
TCCAGCTTCCTCAAATATGTGGAGGAGACGGTGACGGATGTCAGGGGCTATCAGCATTACCCCCTGCGCAGGGTT
CAAGCTGCGGAGGCCTTTAACTCGCTTTTCCTATTCCAAAAGACGCCCAGACAGAATGAGGCGTCGACCCGGCTG
TTTCGGTCCATCGACGGCCAGTCAGCTGTCGAATATCCGGTCTGTGTCGAGGCCGAGCCCGTCGACGATGGACTT
GTTTGGCGTGTCGCCTGCCACCGACAACTCTTCTCCAGCCAAGACACCCAGCTGCTACTCAGTAGGTTGGATCAG
GTGCTACAGTACATGTTTGACCACGAGGCCATTGCTGTCCTCTCCTTCGAGGATGAGGGCGTGTCGATTTGCGGG
CTGCCGGTGCTGGAGGTCGAGGAAGGGCGTGTCCTCGACTGCCGGCCCGACGTGACCGACGACCAGCCAAGCGAG
CAGGAAACCTGGGGAGACACGGCTACTGCAATTCGCCATGTCTTGAGCCAGGTTTCGGACATGCCAGTCGAGTCG
ATAACGCTTCGATCCAGCCTGTACCAGCTCGGCCTCGACTCCATCAGTGCCGTCAAGGTGTCGATGCTACTCCGC
AAGAGAGGAATCGAACTAAAACCGAGGCAGCTCGTCAAGCTGTCGAGCTTGAGGGAAATGGCAGACAACGTGACG
CTCGCAGGACAAGACACTAAGAAGCAGAAGTCCCATCCGGGAGTGACGTGGAAGCCCCCTAGGTCCATGGACGTG
GACGAGCTGCTCCGAGAGTGTAACGTGCCGAGAGACTGCGTCGAGGCGGTGCTGCCAGCGACGCCGATGCAGGCG
TACATGCTGACGGCATGGGAGAAGCCAGGCGGCGCCGTCTTCTTCCCAGAGTTTCACTACCGTATGGACGGCACT
GATGACGTGTTGAGGGCCCAAGAGGCATGGAAGATGCTCAGCGACCAGACGGCCGTGCTGCGAACACGCTTCTTG
GCCACCGGCTTTGATGAGGTACCGTGGATCCAGGCGGTGATGCACAAGGAGGCCATCCGATCCGGCCGCATATCA
CAGCCCCTGGTCCGTCTCGACATCAACAAGGCCGACTCGGGCAAGGGACTGGAGCTGCGACTCAAGATACACCAT
GCCCTGTATGATGAACTCAGCCTGGCAGCCCTGACTTCGCAGCTGTGCGAGCTTGTGAACAGCACGGCAGCCCCT
GAGAGCGACGACGACGACGACGACGACGACGACGACGACGACGGTTTCTCACGGTGGGCGCTCTACTGCAATGCT
CTGCCGGACGGCCGGGCCAGACGGCGAGAGTTCTGGACCGAGTATTTGAGGGGAGGCACCGCCGTCGACATTGAA
GCGTCTTCGGCGACCGACACGGCCGAGAGAGCGTCCTACCTCGACAAGTCAGCCGTGAACGACGTGACGGATCTA
CGGGCAACGGCCTCACAGCACAGCATAAGCCTGCAAGCACTCGTCTTAGCCGCGCTGGCGAAGAGCCTGGCCGGA
CGAGACTCGGAGCGTGCAATCATCCTGGGCATCTACCTCGCCAACCGAGCCGGCGGCGAACGAGACTCGCCACCT
GCGACGTGTCCGACGCTCAACCTAGTGCCGGTCAAGGTGCAGCCAAGTCCGGGCCTCCGTCTTGTCGACATGGCG
AGGGCGATTCAAGCCGATGTCGTCAGCATAGGCGACGACGGACGAGCCCAAGTCGGGCTCTGGGAGATTCTGGCC
TGGACGGGCGTCCGGATCGGCTGCTTCGTCAACTTTCTCGTCGGCGGCGCCAAGGTGGACCGCGTCGGGGATGTC
GTCACTCTCCGTTCCGTACAAGGAGACGTCATGCCCATCATGGTGATGGGAGAAGCGTCGCCGCGCGGGCCCAGG
AGGAACGTGGTTAGCGACGCGGTCGAGCCTTCGGTCGACATCGAGGCCTCGGTCAGCGGGGACAAGGCTCTCGCC
GTCGGAGTCTTTGGCCCGAGGGGGCGCGTGACGGACGAGTGGGCCGCCAAGCTGGTTGCCGATACGGTTGCGTTC
CTGGCCGAGGCGGGCGCGGGCGGT
Transcript >Ophio5|1454
ATGGCCGCCCAAGGCTTGTCCATCATCAATCCGCGTCCAACCAGGTTGTTGGGTCCAAGCTTGCTTCATCAGCTA
ATCGCTCCGCCTTCCGAACACTTAGCTCTTGATCAGCTGGGCCAGGACGGGAAATGTTCATACACGTATCGAGGC
TTGCACAACGCCGCTGCAGCCATCGCCAGTCTCCTCGTTGACGTCCGTTCATCGGTTGCACGGAGCCGCACTCCA
TTCGTCGTCCCTGTACTCATCCCGCAGTCGTCCTTACTTTGCATCTCTCTGCTCGCCGTTCTCAAAGCTGGCGGT
GCCTTTTGTCCTCTCAACCTCGATGCCCCTCGTGAGAGAATCAAGTTTATTCTTAACGATGTCTCCGCCACTGTC
GTCCTCGTCTCACGCTCCACGGCGCATTTGGTGCCCGCGGAAAACCATGTACAAGTTATAATGGTGGATGACATC
GACAATGGGAAAACTTCCATGCCAACTCCTGATCATCAGGAGCCTACTCCAGAGGACGTGGCCTATGTCATGTAC
ACGTCTGGATCGACCGGGACGCCCAAAGGCGTATGTATCCCTCATGATGCCGTAACGCAAGCCCTCCTTGCCCAC
GACCGTCACATACCGGCCTTTTCCAGGTTTCTGCAATTCGCCGCACCTACGTTCGACGTCTCAGTCTTCGAAGTC
TTCTTCCCCCTTTTTCGCGGTAGCACCCTGGTCACTGCCCGCCGCGATGAGCTGCTGGATGACCTGCCATCGGTT
CTTCGGAAGATGAACGTCGATGCCTGCGAGTTGACGCCCACAGTCGCTGCGAGCCTGCTCAGAAGACGCCAGAAT
GCGCCCGCTCTCAAGCTTCTCCTGACCATAGGCGAGATGCTGACCCTCCCCGTCGTCGAGGAGTTTGGCGGGTCT
GAAACAAGGCCCAGCATCCTCTGGGCCATGTATGGGCCAACAGAAGCAACCATTCATTGCACGCTGCAGGCCGCC
TTGACGTCTGAGTCATCAACAGGGAACATTGGAAGCCCCCTTGATACAGTTTCCTGCTTCGTCGTTGAGCCTCGG
GCCTCTGGCCATGACCAAAGCGCCTTCAAAGTTCTCCCGCAGGGCGAAGTCGGTGAATTGGCCGTCGGCGGCTAC
CAGTTGGCCCGCGGTTATCTAAACCGCCCAGAACAAACAGCTTCTGCTTTCATCACCACTCCTTACGGTCAGGTT
TACCTTACGGGAGACAAGGCTCGCGTGACGCCTGATGGAAAGCTCGAATGTCTCGGTCGCTTGACGAGCGGGCAG
GTGAAGCTGCGTGGCCAGCGCATCGAGACTGGTGAGGTGGAACAGTCGGCTCTGAAGACACCAGGCTGCCATGGC
GCTGTAGCAGCCGTCGTTGACGCCAGTTTGGTCCTATTCTGCGCCGTCGATCCAGGCACTTCTGAGGATGCCATT
GCCACGAGCTGCAGCAACTGGTTGCCCGGCTTCATGGTCCCAGGGGAGATTGTCTTGATGGTTGAGTTTCCTCGC
TTGCCAAGTGGAAAGATCGATGCACAGAAGCTCAAGTCAATCTATCAGGAGCAGAAGTTGGCCGAATTTTCTGAG
CACGACGAGATGGTGCTCGCTGAGGAGGAAGTGATTCTTCATGTGATCTCGTCTGTTTTGGAACGACAAGTAAGC
AAGCAGATGACACTGGCCTTTGCCGGCGTAGATTCACTTTCAGCAATCAAGCTGGCGTCTGCGCTGCGACTGTCA
GGCTTCGGGATGAGTGCCTCTGATATGCTGAAACTGAAGACAGTAGCAGACCTTTGCTGTCATATTCGCAAACGA
CCCATGATGAAGCTGTCGAACCATGAAGTTTTCAGTGTAAGCATACTGGCCGACTGGGGCCATATCCTTGCTCAG
AACCCCGGATTGGACCTGGCAAAAAGAAACATGGATGACGTTATCCCCTGCACTTCGCTTCAAACGGCTTTGTTG
GCTGAGACGGCGCGCGATCCCCAGCTCTATTGCAACCAGCTCGAGTTTCAGGTCGCACCAGGATATACAGTCAGC
GACGTTGCGGATGCAATCTGCCAAGTTGCGGCGGAAAACGAAGTCCTCCGCTCAGGCTTCGTTTCGTTGCGTGGT
GGATATGCTGTCGTCTTGTTCAGGGACTTTGGGACCGACGATAACCTCCGCGTCGTGCCACAGTTTGACGAGAGC
TTTTCGTTTCTGCATCCGCACGACTTCCTTAAGCCATTCCGAGTTCAGATCTGCAACAAGGAGAAGGATGCTGGA
CTTCGAGTTCTTTTCCAGGTTCATCACGCCGTCTACGACGGTTGGTCCATGGATCTGATCTTGTCCGACTTGTCC
GCGCTGCTGCGACGTGTTCCGCTCTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGACATCACCTGAGAGACTTC
AAGGACGTCGAAGATGACTCGGCGATGAAGTTTTGGGGCGAGCACCTGACGGGATGGAACAAGTCCTCTTTCCCG
AAGCTGGCGGCTCAATCCCCTATGTCGAATGAGGTTCAGACAAGGAGCCACACGTTGGAGATACTGCCCGAGCAG
GTAAAGCGAATGGCAGGAGAGTGGGCGGTAGGTGTCCAGGTGCTGTTCCAAGCATCTTTGGCTCTGCTATGGAGT
GGCATCGCTGGAGAGCAAGATATGGTGCTTGGGTCCGTGACTTCTGGGCGGACAATAGCCGTGGATCAAATCGAG
GAGATAGTCGGGCCTTGCATTGCGTCTCTGCCTTTCCGAGTCGATCTCAACAACATGATTTCTGTCAAGGACTTA
CTGCCGTCTGAGAGTCTATACGACATTCTCATCGTCTATCAGGAGTCTCTCGAGAGCTTGAAAAAACAAGACTGG
CTCCTTACCGAACCTCGCGAATCATGTTACAGGATCCAGGCCACCTACCACTCTTCGTTCTTTGCGCCTGGTCTA
GTCGACTGCCTCCTCCAACAGTTCGATGACATGACGGGGATGCTGCTGAAGAGTCCCGATATGTGTCTTCGATCT
GTTCGGTCTGCCATGCCCGGGCTGTCGCTCCATAACGAAGCCGTGCAGCCGTTTCTCGGAGTGCCTGACCTTGCT
GCTCAGTTTGAGGCGACGGCGGCCGCCATGCCTACGGCCGCTGCGTTGTGCTTCTGCGACTCGTTCACCTCTCTG
GGTCCCCGGACGCTGTCGACCTCCTATGAAGAGCTGAATAGAGCTGCTAATCAAGTCGCCCATTATCTGTGCAGT
CAGCTGATCCCGATCGGAGAGGTTCTGGCTGTGCTCATGTCAAAATCTCCCACGTTTTACACCACTGTCCTTGGT
GTTCAAAAGGCAGGATGCGCGTACCTGCCCATTCTTCCCCAGACGCCCGAGGTGCGGGTGCGCACCATTCTCAAG
CAGGCTGGAGTCAAGCACTGCCTCGTTGATAATGCCTCTTTACCGATGTTCTCGCTTGAAGGCGTGCGGATTCAC
GACGTGGAGCGCGTCGAGATGCAGCGTTACTCGCCAGATAATCGGAACATCCCACGCACTGCTTCTCGTCTGGCC
TATGTCATCTACACTTCAGGAACTACAGGGGTGCCGAAAGGCGTTGCTGTCACGCAGGAAAACATCGTCAGCAAC
ATCACAGTCTTGCGATCCATCTACCCCAAGCCCAAGACGGCAGAGCCGCGACTGCTCCAGGCCTGCTCCCAAGCG
TTTGACGTGTCTGTTTTTGAGATATTTTTCGCCTGGCACGCGGGCATGTGCCTGTGTGCAGCCCCGAACGACATC
TTATTCCAAGACCTGGAGCGCTTCATGCGCCTGTTGAAGATTAGCCACTTGAGCTTGACGCCGACGTTGGCCTCG
CTCATAGATGCCGCCAAGGTACCAGGTGTCGAGTTTCTCGTCACTGCCGGCGAGCCGATGACGCTGTCCGTTTTG
GATCGATGGCACGACCGGCTTTGGCAAGGATATGGGCCGTCCGAAACGACCAACATATGCAGCGTGAAGCACATG
GCACGCGGAGAAAACATTGAGCATCTTGGCTGGGCTCTGCCCAACACGTCGACGTTTGTCATGCGGACCATGGCC
GCGGAGACTGTCCCCGTCGGATGGGTGGGCGAACTCTGCTTTGGCGGCCATCAGGTCGCGTGGGGATACTTGAAC
GACACTCGTCTGACGAAGGAGAAGTTTGTCCATCACCCCAAATATGGAAGGATTTACCGTTCTGGAGATCTGGGT
CGAATGCTCCCTGATGGCTCGCTGGTGATCCTTGGCCGGCTCGACGATCAGATTAAGCTGCGAGGCCAGCGGATC
GCAGCCGGCGAAATCAACAGTATCATCACTTCCACCAATCTGGCAACCACTGCCGTGACGGTCTCTGCTCGACGG
CGGAAAGACGCACCAGAGCAGCTGGTGTCGTTCTTCGTCCCCTTTGAAGCCCGAACTGAATACCGGACGATGGAG
ATCTCGCCGGAAGTCAACCGCCATCTCTTCGCAAGCTTGTCATCTCGGGTGCCGCCGTACATGGTGCCATCCTAC
TTGATTCCCGTATCTCAAATACCCACGACGGCTAGTGGCAAGGTAGACTGGCGACGCCTTCGAGAGAGTTTTGAG
GACTTGACCGGGCATCACGCCGAGGCTGCCTCTTCCACCACGCAATGTCTCGATGGCGCGAGCGACTGGACTGTA
AGGGAATCGATTCTTGCCGACGTCATCGCGCGTACGACAAAGGTCCCGCGAGATGAGATAAGACGGTGGACGCCG
TTCGCGGCCCTGGGCGTAGATTCCATTACTGCCATTGACTTGTCTCGCACGCTGGGCTCTCGCCTGGAGACCTGG
GTGTCGATATCCTCCATTCTTCAGAACCCGTCCGTTGCTCAGCTGGCCAAGTCGCTGGAGATGAAGGGAAGGCTC
GGTGACGAAACCGCCTCTCAAAAGTCTGACGCTCTGTTTACAACCTTGTCCGGCGAGGTTGGTACCGCCTTGGGC
CGAGACCCGGGAGATATCGAAGAGATCCTTCCGTGCACGCCACTGCAGGAAGCCATGCTTTCGCAAGGGACGGGA
AGCTATTATAACAAGATCCTGCTGCGACTCCGCATCCAGGCCGATGACCTGAAGGCCTACTGGGATGAGATGTCC
AAACGACACGGAATTCTCAGAACCTGTTTCGTCACGACGCGGCGCGCCGAGCATCCGATTGCGCAAGTAGTCCTG
AGGCGATGGAGGGTGTCGTGGAAGACGTATGACGTTCACGCGCCCTCCCTTGCTGGCGTATCCGACGAGCATCTG
AAGTGCCTTCCGGAGCCCCTGAACTCGGGCCTGCCCCCTCTGTCTTGCGCCTTTATGAGATATAAAGGTTCAACT
TTCTTTTCGCTGATCTGCCATCATGCCATTTATGACGGCGTCGCCATGGACAACCTGTGGCGGGAAATCGAAGCC
TTGGCCAACCAGCGCAGCCTTCCCCCCCCTGTGCCCTACAAGCCGTTCATACAGCACGTTGTCGACGCTCCCGAG
GATGTTGATGTGTTCTGGGCCGAGCATTTCCGCGGCTTCCGGCCTTGCAGGCTCTTCAGACGCTTGGCCGGTGCG
CAGGTGAACCAATGTACTCATACCAGCTCTTTTGGCGTGACGTTGATGGAGGTCCAAGAACGCTTAAGATGGCTC
GGAATCTCTCTTCTCTCTGCATGCCAGACGGCGTGGGCAACACTTCTCTCGGCAGTAAGCGAGAGTCCAGATATT
GCCTTTGGTACCGTCGTCAACGGCCGTATCGCCGACATGGAAGGTCTGGACCGGTTGATTGCCCCCTGCTTCAAC
ACTATTGCGATGCGTGTCGACCTTGCAAGCATTTCCCAGAACATCGAATTAGCCAGACAGTTGCAAGATGTCAAC
GTACAGATGATCCCGTATCAGTTCACGCCATTGCGACAGATTCAGAAGATCGTCAACTGTCAACGTCGGGCATTG
TTTGATACCTTGCTGCTCCTTCAGCAACCACTCAAGGAGATGGACGACAGCGTTTGGACACTCGAAGAGGATTCA
GGAAACATGGACGTCCCGCTGGTGTGCGAGATGGTTCCATGTCCAAACCTCAACTCGATCGTCCTCAACGTCCAT
TATGACATCGGAATCGTCTCCAGGGACGTTACTGCATGTCTGGCCGACATCTTCATATACCTTTTCCGTCGTCTG
ATTGACATGCCGCTCGCGAGCCCAGATGATAAGAGCACCTTACCAGAGGCTCTGAAGTTGGGTCTCGTGGATCTC
GTCCCAAGGCGTGACAGGCCAGAGGGTAAAAGCCGCCGGCGATATGAGGACGAGAGCTGGACCGACACCGAGAAG
GTGATTCGGGGAGTCTTCTCGGAGCTTTCTGGTGTGCCGCAGACAAGGATCGGCCGTGATACCAGCATATTCCAG
CTCGGATTGGACAGCATCAACGCTGTTCAGGTCGCTTCGATGCTCCGGCAGAAGGAATATAGGGTTTCTGCGTCG
GAAGTCATCGAGTGCGCCAGCTGTGCGAATTTGGCCTGTCGACTGCTCTACGCCTTCGAAGAGAAGCTGCCGGAG
ACAACGCAGGCGATCAGCCTGCACAAATTCGCCGACGACGTCTCCTCACAAGTACTTAACGCGATGTCGTCTGAT
AACCAATTTGAGGCCGTTCTCCCTGCCACGCCCATGCAGTCGGCCATGCTGGCCTCATTTCTCTCCTCAAAGGGC
CACAAATACCTCAACATGCTGGCAATGGAGATGGACGACAACATTGGCGTGGAAAGCCTGCATGGGGCTTTCGCA
GTCCTCCAGCGGCAGCATCCGATGCTCCGTACTGGCTTCGTTTCTGTGAGACATAAAGAGAGCTCGTTTGCCATG
GTACGACATGAGGAGGCTTTCGGCGGCTTGCCTGTTGAGAGCATCCATCTCGAGCGGTTTCAGACGTTCGACTTG
TGTGAATGGCAAGAGGTCACTCGGCGAGACATGCTGAAGCTTCTACATCTGCCACTTTGGAAAGCGGTCTTGGTC
AAGCAAGGGGATCGGCTGACGCTTCATCTCACCATGCATCATGCTCTCTATGACGCACACTCGCTAGATGAGCTC
CTACGAAGCCTCTCAAGCCTCCTACTCGATGGCAGAGAGCCTAAATTCTCCAGGGTCGAACCAGCTTTGTTGGAG
GTTCTTGCCCGCGGTCGACAAGGGCAGGCGGCTGCTCAAGAGTTCTGGGAGAAGCATGCGGGCAACGCCGTGGTG
AACAAGTTTCCACTTTTGACGCCTTTGAGAGAAGAGACAACGGGTCTGTCAACCCGCGAAACGTCTTCGTCAATG
TCCTCCAGCTTTCTCTTTAACGCCGCCAAGGACTGCGGTAGCTCAATCCAGGCGTTGGTGCAAGCCGCCTGGACA
CGCGTTCTGGCCTCGTATCATGGCGAGAGCTCGGTTGTATTTGGGATCACAATGTCAGGGCGTATCACCGACCAC
GGTCGAGCCGCTCCGTTTCCCTGCATCGTCACCATCCCAGTTGTGGCGCGTAACATGGAGTCAAACAGACAGCTT
GTCGAAGCAATGATGGAGTATAATGCCGAAATGCACAAGCATCAGTTCACCCCGTTGAGTCGGATCCAGAAATGG
TTAGGTCATCCTGCCACTTCCGTCTTCGACACGCTTGTTGTCTATCAAAAGAGAGACGGACCGAAGACGGCACGC
CCGCCTTGGAGGTTGGTCAAGGATGAAGCGGTTGTTGACTACGCCGTCTCTCTCGAGGTCGAGCCGAATGCTGAG
GATGATGATAAACTATGCCTCCGGCTCACCTTTGCCAGAAACCTCATACCGGAGGAACAGGCGCACCTCATCGTT
CAACAGTTCGACGCCACACTGCATCATCTGGCCAGCGAGCCTACCGGGAACGAAGATGGACTCTACAGAAAGCGA
CCTGATCTTTTCGCAGTCACCCCGGCTTCGATGCCAGACATGCCTGCTCCGGTACAATTTCTTCATGAGTTCGTG
GAGTATAGCTGCAGGACTTGGCCAGAAACAACGGCCTTGGAGTTTGTGGACGACTGGGACAGAAAGTCGGGCACG
AAAAGATGGAGCTACAGAGAACTCGATCTGATGGGAAACCGCGTCGCTCATCAGCTGCGAGAGCATACCCTTCCC
GGAGACGTGGTGGCACTTCACTTTCAGAAATGCGCCGAGGCGTATTTTTCGATCCTCGGTGTCCTCAAAGCCGGC
TGTGCATTCGTCGCCCTCGACCCTCATGCTCCGAAGGCAAGGAAGAACTTCATCTTGAATGATTCACGTGCGAGG
TGCCTTTTAGCGGAGGACGGAGTGGTGATAGATGTCGACGTTCCCATCAAAGTGCTGGGAATCGCCGAGGAAACG
CTTCGAAAGCTGTCGTACGAGCGTCCGTCTTGGGTCGGGAGCAGTCTGACGCCTGCCCACACCTGCTATTGTCTT
TACACGTCCGGCACGACGGGGACGCCCAAAGGATGCGAGATCAGTCACGAGAATGCGGTCCAGGCCATGATGGCC
TTTCAAGACCTGTTCCAAGGGCACTGGGACGCCGACTCGCGCTGGCTGCAGTTTGCGGCGCTTCACTTTGACGTC
TCCATGCTCGAGCAGTACTGGAGTTGGGCAGTGGGCATCACGGTCGTGTCCGCGCCCCGAGATCTGATCCTGGAC
GACCTCGCCGGGGCAGTTAGGAGGCTCGGCATCACCCATGTCGACCTCACCCCTAGTCTGGCCCGGCTGACGAGT
CCTGAGGAGATGCCGAGTCTGCGCGTCTTCATCACGGGAGGAGAGCAACTGAAGCAGGAGATTCTCGATAAATGG
GGCCCAAAGGCCGTCATCTACAACGCCTACGGCCCTACGGAGGCGACCATCGGCGTGACCATGTGTCCGCGCGTG
CCCGTCAACGGACGCCCGAGCAACATTGGTAAACAGTTTCTCAATGTCGGCTCTTACGTCTTTCGTCCATTGACC
GAGACTCCTGTCCTACGAGGTGCCGTCGGGGAGCTGTGCGTGTCAGGCAAGCTGGTGGGCAAGGGATACCTGCGC
CGTCCAGAGCTCACCAAGGAGCGGTTCCCGACGCTCGTCGAGTTTGGTGAAAGGGTCTACAGGACGGGCGACCTG
GTGCGGATCCTCCACGACGGATGCTTTGAGTTTCTTGGCCGCGCAGACGATCAGATCAAGTTGCGCGGACAGCGG
CTGGAGATGGGCGAGATTAACCACGCAATCCGCTCAGGGGCGGCGGGCGTTCTCGATTGTGCAACGCTCTTGGTG
CACAGAGAGACTCCGGACAAGGATGTCTTGGTGTCCTTTGTTGTCGGACGGGCGTCAACCGGCCGTCAAAGGCTC
TCCACGTTGCAAGACCCCGACGGACTTGGTGCTCAAGCAAGAACGGCTTGTCTTGGGAGGCTGCCGGCCTACATG
GTGCCAACATATTTCCTCCGGCTGCCGTACATACCTCTCTCGCCGAACAACAAGGTCGAAGCTAAAGAGCTCAAG
TCGTTGTTTCAGTCTCTCTCGCATGAGGAGCTGATGAAGCTGTCGGCCGCTGCTGTGGCTCTCCCGACGAGCCTC
GACGAGGCCGGCACTGGCAGCATCATCAGCATCGTGTCCGAGTTTAGCGGCGTCGCAGAAGACAAGTTCACGCCG
TCGACCAGCCTGTTCGACGTCGGCGTGGACTCCATCACCGCCCTGCAATTGACCGCCCGGCTTCGCGAACGAGGT
TTCCGGGCTGCCTCTCCCGCTGTGTTGCTGAAATGGCCCATCATCGCGCACCTCGTCAAAGCCCTGGCCGACAAC
TCCTCAGAAGTAGCAAGCATCATGGTTAGCGGTGTGAGGGAAGCTAAACAGCTCCTGCAGGCCTGTCACTACAGA
TATCTCCCATTCGTGTGCCGCGAGCTGGACGTGGGGCCTGATGAGGTTGAATATATTGCGCCGTGCTCGCCGCTG
CAACAGGGCATCATCTTCAAAGCTCTCAGTAACGAGAGCTCCGACCCTTACTTTTCCTCTTTCGAGCTGAGACTG
GATAGAGGCGCCTCGGTTGACAGAGTCCGCGACGCCTGGAGTCGGACTGTTGATGCTCACGCCATACTTCGATCT
GTTTTTGTCAACACCCCTGATGGGCATATTCAGGTCGCAATGCGTCAGACAAAGGGTCAATGGCAAGACGTGAAA
TTTGAATCTCAAGACGAACTCTTTCTCACCATGGAAACGAAAAGGCGAGATTGGGTTGCGAAAAACAGGCATCAC
TTTGGCCGCCCCATCGAGCTCATTCACGCGCAGGGGCCGGACTCTCAGAGGCTCTTCCTCCACATCTTCCATGCG
CTCTACGACGGCAGCAGCTTGCGACTCATCAGCCACTATGCCAAGGCCCTGTACCGCGACGAGCAACCGCCGTCA
AGCCCCCCATTTATCGAGGCCTTGAGCCACGGGCCGCTCTCAAGACACGATCAGTGCCGACAGTTTTGGACGGAG
CACATGCGTGGCTGGACACCGTCACCAGTGCCGACGCTCGCAGCATCGTCAGACGAACTCAGAGGCGTGACAGTC
AGTCGCAACGTTCCGCTGGCCCTACTCGAGGGGCTGCGACGTCAACAAAACGTCACGATGCAGTCTGTCGTGCTC
GCCCTGTGGACTTCGGTCCTCCAGAGATGTCTGACCAGCAGCGTCACAGTTGGCGTCATTCTTTCAGGCAGGTCT
ATTGACCTTGCTGGGGTCGAGCGGACAATCGGCCCTCTGTTCAACACCGTGCCCTTCTTCGTCGACGCCCTGCGA
GAGCGCACTTGGTCGTCGTTGATCCGCGAGGCCCATGGCTTCAGCACTTCGGTAATGCCTTTCCAACATGTGCCC
CTGAAGGACATCCAGTCATGGTGCTCTGGAGGCCGTCCGCTTTTCGACAATCTCTTTGTGTTCCAGCTTGAACAG
CCTGAATGGTGCGACGAAGCTGCGCTTTGGGAGGTCGAAGACGGTCCGGATCGCCCCGATTACCCCCTGGCGCTC
GAAGCGACGCGAACATTAGGGGGGAACTTACGGCTATGCCTTGTGTCGCAAAGCCGGTATGCTGATGCAGTCATG
CTGGAGGGCATGCTGGACCAATTCGAACAGGTGATGGCGACAGCCGAGGCGGAGGCAACGGGGAGTCCTTGGCAA
GGCGCTACAGAGCCCAATCAGGGGGTGTTAGTCGGGAACTCTGGAGAGGAAGAGGCGGAGGTCATGTTCGACTGG
ACGGAGGAAGCTGTTGTGGTGAGGAATGAGTTGGCGCTACTTGCCCGCATACCCCCTGAACAAGTCGGCGCAACA
ACTATGCTGCTGGAGCTGGGCCTTGACAGCATTGATGCGATGAAGCTCTCAACAAGGCTGAAGCAGCGTGGAATC
AACGTATCTGCGTCAAACATACTGCGAAGCCAGACGATAGCCCGTCTCGTTGGTCAGCTGGAGATGAGCGGCGTT
GCGCTTCCATCCAACTCTGAGTCTTCGAAACTCCTCGAAGAGATAAGATCTAGGCTCTGGATCGAGGTAGAGAAT
GGTGTGACAGACGCGAAAATGGTTGAGTCGGTCTTGCCTCCGACTCCTCTCCAGGAAGCCATGGTTTCGGGCATG
GTTCAGTCAGGCTTTCAGTGGTACTTCAACCACGATATCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTT
GGTGCCGCGTGGAGGCAGCTGATCGAGGCATCGCCATGCTTGAGAAGCGGCTTCATCGAAGTTGGCGACTCGAAT
CTGGACGTGTCGTACTGCCAAGTCACCTTCAAGAGCAGAACTTGTTGCGTCAAGACGCGGGCGCTGGCGGACAAG
TCTGAGATGGGACAGGTGATGCTGGACGCGACGCGGCTGGCTGCTCAAAGCAAGGGACTGCAAGACTTGGTGCAG
ATTGCGCTGGTGACGGTTGGCGAGCGACGTCTCGTTGTCGTTTCCATGGCTCATGCTCTCTACGACGGTTGGTCG
CTCGGGCTCATGTATCGGGATCTGGAAGAGCTGTACTGGGGGCGGGAGAGGAAGACACAACAAACATCCACCGAT
GCTTTTGTTGGGCGCGTTCTGGCCTGCAGGACGGAAGAGGCCCGCGGTTTCTGGACTGGTCATCTCGCGGGCCTT
CGGCCGACTTTGTTGACAGGAAGGGCGAAGACGACAACGAAAACAGGAGACTGGCCGTTGCGCAAAGAAGCTCCG
TCCGGCTGCAGTCTCTCTCAACTAACAAGCTTCTGCAAGAGGCAGGCAATCAGTCTACAGGTGCTCTGCGTCGCC
ACATGGGCTGTCGTCGTGGCGGAGCGAACCAGGGGCCTCGATGTCGTCTTCGGACTCGTGCTGTCTGGCAGAGAC
GGAGAGGGGACGGAGGAGCTGATGTTGCCGACCATGAGCACAGTGGCCTTGCGCTGCGTCCTTCACGGCTCCGTC
TCCAGCTTCCTCAAATATGTGGAGGAGACGGTGACGGATGTCAGGGGCTATCAGCATTACCCCCTGCGCAGGGTT
CAAGCTGCGGAGGCCTTTAACTCGCTTTTCCTATTCCAAAAGACGCCCAGACAGAATGAGGCGTCGACCCGGCTG
TTTCGGTCCATCGACGGCCAGTCAGCTGTCGAATATCCGGTCTGTGTCGAGGCCGAGCCCGTCGACGATGGACTT
GTTTGGCGTGTCGCCTGCCACCGACAACTCTTCTCCAGCCAAGACACCCAGCTGCTACTCAGTAGGTTGGATCAG
GTGCTACAGTACATGTTTGACCACGAGGCCATTGCTGTCCTCTCCTTCGAGGATGAGGGCGTGTCGATTTGCGGG
CTGCCGGTGCTGGAGGTCGAGGAAGGGCGTGTCCTCGACTGCCGGCCCGACGTGACCGACGACCAGCCAAGCGAG
CAGGAAACCTGGGGAGACACGGCTACTGCAATTCGCCATGTCTTGAGCCAGGTTTCGGACATGCCAGTCGAGTCG
ATAACGCTTCGATCCAGCCTGTACCAGCTCGGCCTCGACTCCATCAGTGCCGTCAAGGTGTCGATGCTACTCCGC
AAGAGAGGAATCGAACTAAAACCGAGGCAGCTCGTCAAGCTGTCGAGCTTGAGGGAAATGGCAGACAACGTGACG
CTCGCAGGACAAGACACTAAGAAGCAGAAGTCCCATCCGGGAGTGACGTGGAAGCCCCCTAGGTCCATGGACGTG
GACGAGCTGCTCCGAGAGTGTAACGTGCCGAGAGACTGCGTCGAGGCGGTGCTGCCAGCGACGCCGATGCAGGCG
TACATGCTGACGGCATGGGAGAAGCCAGGCGGCGCCGTCTTCTTCCCAGAGTTTCACTACCGTATGGACGGCACT
GATGACGTGTTGAGGGCCCAAGAGGCATGGAAGATGCTCAGCGACCAGACGGCCGTGCTGCGAACACGCTTCTTG
GCCACCGGCTTTGATGAGGTACCGTGGATCCAGGCGGTGATGCACAAGGAGGCCATCCGATCCGGCCGCATATCA
CAGCCCCTGGTCCGTCTCGACATCAACAAGGCCGACTCGGGCAAGGGACTGGAGCTGCGACTCAAGATACACCAT
GCCCTGTATGATGAACTCAGCCTGGCAGCCCTGACTTCGCAGCTGTGCGAGCTTGTGAACAGCACGGCAGCCCCT
GAGAGCGACGACGACGACGACGACGACGACGACGACGACGACGGTTTCTCACGGTGGGCGCTCTACTGCAATGCT
CTGCCGGACGGCCGGGCCAGACGGCGAGAGTTCTGGACCGAGTATTTGAGGGGAGGCACCGCCGTCGACATTGAA
GCGTCTTCGGCGACCGACACGGCCGAGAGAGCGTCCTACCTCGACAAGTCAGCCGTGAACGACGTGACGGATCTA
CGGGCAACGGCCTCACAGCACAGCATAAGCCTGCAAGCACTCGTCTTAGCCGCGCTGGCGAAGAGCCTGGCCGGA
CGAGACTCGGAGCGTGCAATCATCCTGGGCATCTACCTCGCCAACCGAGCCGGCGGCGAACGAGACTCGCCACCT
GCGACGTGTCCGACGCTCAACCTAGTGCCGGTCAAGGTGCAGCCAAGTCCGGGCCTCCGTCTTGTCGACATGGCG
AGGGCGATTCAAGCCGATGTCGTCAGCATAGGCGACGACGGACGAGCCCAAGTCGGGCTCTGGGAGATTCTGGCC
TGGACGGGCGTCCGGATCGGCTGCTTCGTCAACTTTCTCGTCGGCGGCGCCAAGGTGGACCGCGTCGGGGATGTC
GTCACTCTCCGTTCCGTACAAGGAGACGTCATGCCCATCATGGTGATGGGAGAAGCGTCGCCGCGCGGGCCCAGG
AGGAACGTGGTTAGCGACGCGGTCGAGCCTTCGGTCGACATCGAGGCCTCGGTCAGCGGGGACAAGGCTCTCGCC
GTCGGAGTCTTTGGCCCGAGGGGGCGCGTGACGGACGAGTGGGCCGCCAAGCTGGTTGCCGATACGGTTGCGTTC
CTGGCCGAGGCGGGCGCGGGCGGTTAG
Gene >Ophio5|1454
ATGGCCGCCCAAGGCTTGTCCATCATCAATCCGCGTCCAACCAGGTTGTTGGGTCCAAGCTTGCTTCATCAGCTA
ATCGCTCCGCCTTCCGAACACTTAGCTCTTGATCAGCTGGGCCAGGACGGGAAATGTTCATACACGTATCGAGGC
TTGCACAACGCCGCTGCAGCCATCGCCAGTCTCCTCGTTGACGTCCGTTCATCGGTTGCACGGAGCCGCACTCCA
TTCGTCGTCCCTGTACTCATCCCGCAGTCGTCCTTACTTTGCATCTCTCTGCTCGCCGTTCTCAAAGCTGGCGGT
GCCTTTTGTCCTCTCAACCTCGATGCCCCTCGTGAGAGAATCAAGTTTATTCTTAACGATGTCTCCGCCACTGTC
GTCCTCGTCTCACGCTCCACGGCGCATTTGGTGCCCGCGGAAAACCATGTACAAGTTATAATGGTGGATGACATC
GACAATGGGAAAACTTCCATGCCAACTCCTGATCATCAGGAGCCTACTCCAGAGGACGTGGCCTATGTCATGTAC
ACGTCTGGATCGACCGGGACGCCCAAAGGCGTATGTATCCCTCATGATGCCGTAACGCAAGCCCTCCTTGCCCAC
GACCGTCACATACCGGCCTTTTCCAGGTTTCTGCAATTCGCCGCACCTACGTTCGACGTCTCAGTCTTCGAAGTC
TTCTTCCCCCTTTTTCGCGGTAGCACCCTGGTCACTGCCCGCCGCGATGAGCTGCTGGATGACCTGCCATCGGTT
CTTCGGAAGATGAACGTCGATGCCTGCGAGTTGACGCCCACAGTCGCTGCGAGCCTGCTCAGAAGACGCCAGAAT
GCGCCCGCTCTCAAGCTTCTCCTGACCATAGGCGAGATGCTGACCCTCCCCGTCGTCGAGGAGTTTGGCGGGTCT
GAAACAAGGCCCAGCATCCTCTGGGCCATGTATGGGCCAACAGAAGCAACCATTCATTGGTGAGACACAATCCGC
CACCGTTGCCTGCCTTTGTAGATTCTGACCTGGTAAACAGCACGCTGCAGGCCGCCTTGACGTCTGAGTCATCAA
CAGGGAACATTGGAAGCCCCCTTGATACAGTTTCCTGCTTCGTCGTTGAGCCTCGGGCCTCTGGCCATGACCAAA
GCGCCTTCAAAGTTCTCCCGCAGGGCGAAGTCGGTGAATTGGCCGTCGGCGGCTACCAGTTGGCCCGCGGTTATC
TAAACCGCCCAGAACAAACAGCTTCTGCTTTCATCACCACTCCTTACGGTCAGGTTTACCTTACGGGAGACAAGG
CTCGCGTGACGCCTGATGGAAAGCTCGAATGTCTCGGTCGCTTGACGAGCGGGCAGGTGAAGCTGCGTGGCCAGC
GCATCGAGACTGGTGAGGTGGAACAGTCGGCTCTGAAGACACCAGGCTGCCATGGCGCTGTAGCAGCCGTCGTTG
ACGCCAGTTTGGTCCTATTCTGCGCCGTCGATCCAGGCACTTCTGAGGATGCCATTGCCACGAGCTGCAGCAACT
GGTTGCCCGGCTTCATGGTCCCAGGGGAGATTGTCTTGATGGTTGAGTTTCCTCGCTTGCCAAGTGGAAAGATCG
ATGCACAGAAGCTCAAGTCAATCTATCAGGAGCAGAAGTTGGCCGAATTTTCTGAGCACGACGAGATGGTGCTCG
CTGAGGAGGAAGTGATTCTTCATGTGATCTCGTCTGTTTTGGAACGACAAGTAAGCAAGCAGATGACACTGGCCT
TTGCCGGCGTAGATTCACTTTCAGCAATCAAGCTGGCGTCTGCGCTGCGACTGTCAGGCTTCGGGATGAGTGCCT
CTGATATGCTGAAACTGAAGACAGTAGCAGACCTTTGCTGTCATATTCGCAAACGACCCATGATGAAGCTGTCGA
ACCATGAAGTTTTCAGTGTAAGCATACTGGCCGACTGGGGCCATATCCTTGCTCAGAACCCCGGATTGGACCTGG
CAAAAAGAAACATGGATGACGTTATCCCCTGCACTTCGCTTCAAACGGCTTTGTTGGCTGAGACGGCGCGCGATC
CCCAGCTCTATTGCAACCAGCTCGAGTTTCAGGTCGCACCAGGATATACAGTCAGCGACGTTGCGGATGCAATCT
GCCAAGTTGCGGCGGAAAACGAAGTCCTCCGCTCAGGCTTCGTTTCGTTGCGTGGTGGATATGCTGTCGTCTTGT
TCAGGGACTTTGGGACCGACGATAACCTCCGCGTCGTGCCACAGTTTGACGAGAGCTTTTCGTTTCTGCATCCGC
ACGACTTCCTTAAGCCATTCCGAGTTCAGATCTGCAACAAGGAGAAGGATGCTGGACTTCGAGTTCTTTTCCAGG
TTCATCACGCCGTCTACGACGGTTGGTCCATGGATCTGATCTTGTCCGACTTGTCCGCGCTGCTGCGACGTGTTC
CGCTCTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGACATCACCTGAGAGACTTCAAGGACGTCGAAGATGACT
CGGCGATGAAGTTTTGGGGCGAGCACCTGACGGGATGGAACAAGTCCTCTTTCCCGAAGCTGGCGGCTCAATCCC
CTATGTCGAATGAGGTTCAGACAAGGAGCCACACGTTGGAGATACTGCCCGAGCAGGTAAAGCGAATGGCAGGAG
AGTGGGCGGTAGGTGTCCAGGTGCTGTTCCAAGCATCTTTGGCTCTGCTATGGAGTGGCATCGCTGGAGAGCAAG
ATATGGTGCTTGGGTCCGTGACTTCTGGGCGGACAATAGCCGTGGATCAAATCGAGGAGATAGTCGGGCCTTGCA
TTGCGTCTCTGCCTTTCCGAGTCGATCTCAACAACATGATTTCTGTCAAGGACTTACTGGTGAGCATCCAAACAA
GCAACCGGGCAATCATGCAACACAGCGCGCTGCCTCTTGCGGAAGTCAGAAAACTGGCAGGACTTCAGCCGTCTG
AGAGTCTATACGACATTCTCATCGTCTATCAGGAGTCTCTCGAGAGCTTGAAAAAACAAGACTGGCTCCTTACCG
AAGTACATCACTTGGATCGTCTGGAGACGAAACTCTTGCTTGAGATACAGCCTCGCGAATCATGTTACAGGATCC
AGGCCACCTACCACTCTTCGTTCTTTGCGCCTGGTCTAGTCGACTGCCTCCTCCAACAGTTCGATGACATGACGG
GGATGCTGCTGAAGAGTCCCGATATGTGTCTTCGATCTGTTCGGTCTGCCATGCCCGGGCTGTCGCTCCATAACG
AAGCCGTGCAGCCGTTTCTCGGAGTGCCTGACCTTGCTGCTCAGTTTGAGGCGACGGCGGCCGCCATGCCTACGG
CCGCTGCGTTGTGCTTCTGCGACTCGTTCACCTCTCTGGGTCCCCGGACGCTGTCGACCTCCTATGAAGAGCTGA
ATAGAGCTGCTAATCAAGTCGCCCATTATCTGTGCAGTCAGCTGATCCCGATCGGAGAGGTTCTGGCTGTGCTCA
TGTCAAAATCTCCCACGTTTTACACCACTGTCCTTGGTGTTCAAAAGGCAGGATGCGCGTACCTGCCCATTCTTC
CCCAGACGCCCGAGGTGCGGGTGCGCACCATTCTCAAGCAGGCTGGAGTCAAGCACTGCCTCGTTGATAATGCCT
CTTTACCGATGTTCTCGCTTGAAGGCGTGCGGATTCACGACGTGGAGCGCGTCGAGATGCAGCGTTACTCGCCAG
ATAATCGGAACATCCCACGCACTGCTTCTCGTCTGGCCTATGTCATCTACACTTCAGGAACTACAGGGGTGCCGA
AAGGCGTTGCTGTCACGCAGGAAAACATCGTCAGCAACATCACAGTCTTGCGATCCATCTACCCCAAGCCCAAGA
CGGCAGAGCCGCGACTGCTCCAGGCCTGCTCCCAAGCGTTTGACGTGTCTGTTTTTGAGATATTTTTCGCCTGGC
ACGCGGGCATGTGCCTGTGTGCAGCCCCGAACGACATCTTATTCCAAGACCTGGAGCGCTTCATGCGCCTGTTGA
AGATTAGCCACTTGAGCTTGACGCCGACGTTGGCCTCGCTCATAGATGCCGCCAAGGTACCAGGTGTCGAGTTTC
TCGTCACTGCCGGCGAGCCGATGACGCTGTCCGTTTTGGATCGATGGCACGACCGGCTTTGGCAAGGATATGGGC
CGTCCGAAACGACCAACATATGCAGCGTGAAGCACATGGCACGCGGAGAAAACATTGAGCATCTTGGCTGGGCTC
TGCCCAACACGTCGACGTTTGTCATGCGGACCATGGCCGCGGAGACTGTCCCCGTCGGATGGGTGGGCGAACTCT
GCTTTGGCGGCCATCAGGTCGCGTGGGGATACTTGAACGACACTCGTCTGACGAAGGAGAAGTTTGTCCATCACC
CCAAATATGGAAGGATTTACCGTTCTGGAGATCTGGGTCGAATGCTCCCTGATGGCTCGCTGGTGATCCTTGGCC
GGCTCGACGATCAGATTAAGCTGCGAGGCCAGCGGATCGCAGCCGGCGAAATCAACAGTATCATCACTTCCACCA
ATCTGGCAACCACTGCCGTGACGGTCTCTGCTCGACGGCGGAAAGACGCACCAGAGCAGCTGGTGTCGTTCTTCG
TCCCCTTTGAAGCCCGAACTGAATACCGGACGATGGAGATCTCGCCGGAAGTCAACCGCCATCTCTTCGCAAGCT
TGTCATCTCGGGTGCCGCCGTACATGGTGCCATCCTACTTGATTCCCGTATCTCAAATACCCACGACGGCTAGTG
GCAAGGTAGACTGGCGACGCCTTCGAGAGAGTTTTGAGGACTTGACCGGGCATCACGCCGAGGCTGCCTCTTCCA
CCACGCAATGTCTCGATGGCGCGAGCGACTGGACTGTAAGGGAATCGATTCTTGCCGACGTCATCGCGCGTACGA
CAAAGGTCCCGCGAGATGAGATAAGACGGTGGACGCCGTTCGCGGCCCTGGGCGTAGATTCCATTACTGCCATTG
ACTTGTCTCGCACGCTGGGCTCTCGCCTGGAGACCTGGGTGTCGATATCCTCCATTCTTCAGAACCCGTCCGTTG
CTCAGCTGGCCAAGTCGCTGGAGATGAAGGGAAGGCTCGGTGACGAAACCGCCTCTCAAAAGTCTGACGCTCTGT
TTACAACCTTGTCCGGCGAGGTTGGTACCGCCTTGGGCCGAGACCCGGGAGATATCGAAGAGATCCTTCCGTGCA
CGCCACTGCAGGAAGCCATGCTTTCGCAAGGGACGGGAAGCTATTATAACAAGATCCTGCTGCGACTCCGCATCC
AGGCCGATGACCTGAAGGCCTACTGGGATGAGATGTCCAAACGACACGGAATTCTCAGAACCTGTTTCGTCACGA
CGCGGCGCGCCGAGCATCCGATTGCGCAAGTAGTCCTGAGGCGATGGAGGGTGTCGTGGAAGACGTATGACGTTC
ACGCGCCCTCCCTTGCTGGCGTATCCGACGAGCATCTGAAGTGCCTTCCGGAGCCCCTGAACTCGGGCCTGCCCC
CTCTGTCTTGCGCCTTTATGAGATATAAAGGTTCAACTTTCTTTTCGCTGATCTGCCATCATGCCATTTATGACG
GCGTCGCCATGGACAACCTGTGGCGGGAAATCGAAGCCTTGGCCAACCAGCGCAGCCTTCCCCCCCCTGTGCCCT
ACAAGCCGTTCATACAGCACGTTGTCGACGCTCCCGAGGATGTTGATGTGTTCTGGGCCGAGCATTTCCGCGGCT
TCCGGCCTTGCAGGCTCTTCAGACGCTTGGCCGGTGCGCAGGTGAACCAATGTACTCATACCAGCTCTTTTGGCG
TGACGTTGATGGAGGTCCAAGAACGCTTAAGATGGCTCGGAATCTCTCTTCTCTCTGCATGCCAGACGGCGTGGG
CAACACTTCTCTCGGCAGTAAGCGAGAGTCCAGATATTGCCTTTGGTACCGTCGTCAACGGCCGTATCGCCGACA
TGGAAGGTCTGGACCGGTTGATTGCCCCCTGCTTCAACACTATTGCGATGCGTGTCGACCTTGCAAGCATTTCCC
AGAACATCGAATTAGCCAGACAGTTGCAAGATGTCAACGTACAGATGATCCCGTATCAGTTCACGCCATTGCGAC
AGATTCAGAAGATCGTCAACTGTCAACGTCGGGCATTGTTTGATACCTTGCTGCTCCTTCAGCAACCACTCAAGG
AGATGGACGACAGCGTTTGGACACTCGAAGAGGATTCAGGAAACATGGACGTCCCGCTGGTGTGCGAGATGGTTC
CATGTCCAAACCTCAACTCGATCGTCCTCAACGTCCATTATGACATCGGAATCGTCTCCAGGGACGTTACTGCAT
GTCTGGCCGACATCTTCATATACCTTTTCCGTCGTCTGATTGACATGCCGCTCGCGAGCCCAGATGATAAGAGCA
CCTTACCAGAGGCTCTGAAGTTGGGTCTCGTGGATCTCGTCCCAAGGCGTGACAGGCCAGAGGGTAAAAGCCGCC
GGCGATATGAGGACGAGAGCTGGACCGACACCGAGAAGGTGATTCGGGGAGTCTTCTCGGAGCTTTCTGGTGTGC
CGCAGACAAGGATCGGCCGTGATACCAGCATATTCCAGCTCGGATTGGACAGCATCAACGCTGTTCAGGTCGCTT
CGATGCTCCGGCAGAAGGAATATAGGGTTTCTGCGTCGGAAGTCATCGAGTGCGCCAGCTGTGCGAATTTGGCCT
GTCGACTGCTCTACGCCTTCGAAGAGAAGCTGCCGGAGACAACGCAGGCGATCAGCCTGCACAAATTCGCCGACG
ACGTCTCCTCACAAGTACTTAACGCGATGTCGTCTGATAACCAATTTGAGGCCGTTCTCCCTGCCACGCCCATGC
AGTCGGCCATGCTGGCCTCATTTCTCTCCTCAAAGGGCCACAAATACCTCAACATGCTGGCAATGGAGATGGACG
ACAACATTGGCGTGGAAAGCCTGCATGGGGCTTTCGCAGTCCTCCAGCGGCAGCATCCGATGCTCCGTACTGGCT
TCGTTTCTGTGAGACATAAAGAGAGCTCGTTTGCCATGGTACGACATGAGGAGGCTTTCGGCGGCTTGCCTGTTG
AGAGCATCCATCTCGAGCGGTTTCAGACGTTCGACTTGTGTGAATGGCAAGAGGTCACTCGGCGAGACATGCTGA
AGCTTCTACATCTGCCACTTTGGAAAGCGGTCTTGGTCAAGCAAGGGGATCGGCTGACGCTTCATCTCACCATGC
ATCATGCTCTCTATGACGCACACTCGCTAGATGAGCTCCTACGAAGCCTCTCAAGCCTCCTACTCGATGGCAGAG
AGCCTAAATTCTCCAGGGTCGAACCAGCTTTGTTGGAGGTTCTTGCCCGCGGTCGACAAGGGCAGGCGGCTGCTC
AAGAGTTCTGGGAGAAGCATGCGGGCAACGCCGTGGTGAACAAGTTTCCACTTTTGACGCCTTTGAGAGAAGAGA
CAACGGGTCTGTCAACCCGCGAAACGTCTTCGTCAATGTCCTCCAGCTTTCTCTTTAACGCCGCCAAGGACTGCG
GTAGCTCAATCCAGGCGTTGGTGCAAGCCGCCTGGACACGCGTTCTGGCCTCGTATCATGGCGAGAGCTCGGTTG
TATTTGGGATCACAATGTCAGGGCGTATCACCGACCACGGTCGAGCCGCTCCGTTTCCCTGCATCGTCACCATCC
CAGTTGTGGCGCGTAACATGGAGTCAAACAGACAGCTTGTCGAAGCAATGATGGAGTATAATGCCGAAATGCACA
AGCATCAGTTCACCCCGTTGAGTCGGATCCAGAAATGGTTAGGTCATCCTGCCACTTCCGTCTTCGACACGCTTG
TTGTCTATCAAAAGAGAGACGGACCGAAGACGGCACGCCCGCCTTGGAGGTTGGTCAAGGATGAAGCGGTTGTTG
ACTACGCCGTCTCTCTCGAGGTCGAGCCGAATGCTGAGGATGATGATAAACTATGCCTCCGGCTCACCTTTGCCA
GAAACCTCATACCGGAGGAACAGGCGCACCTCATCGTTCAACAGTTCGACGCCACACTGCATCATCTGGCCAGCG
AGCCTACCGGGAACGAAGATGGACTCTACAGAAAGCGACCTGATCTTTTCGCAGTCACCCCGGCTTCGATGCCAG
ACATGCCTGCTCCGGTACAATTTCTTCATGAGTTCGTGGAGTATAGCTGCAGGACTTGGCCAGAAACAACGGCCT
TGGAGTTTGTGGACGACTGGGACAGAAAGTCGGGCACGAAAAGATGGAGCTACAGAGAACTCGATCTGATGGGAA
ACCGCGTCGCTCATCAGCTGCGAGAGCATACCCTTCCCGGAGACGTGGTGGCACTTCACTTTCAGAAATGCGCCG
AGGCGTATTTTTCGATCCTCGGTGTCCTCAAAGCCGGCTGTGCATTCGTCGCCCTCGACCCTCATGCTCCGAAGG
CAAGGAAGAACTTCATCTTGAATGATTCACGTGCGAGGTGCCTTTTAGCGGAGGACGGAGTGGTGATAGATGTCG
ACGTTCCCATCAAAGTGCTGGGAATCGCCGAGGAAACGCTTCGAAAGCTGTCGTACGAGCGTCCGTCTTGGGTCG
GGAGCAGTCTGACGCCTGCCCACACCTGCTATTGTCTTTACACGTCCGGCACGACGGGGACGCCCAAAGGATGCG
AGATCAGTCACGAGAATGCGGTCCAGGCCATGATGGCCTTTCAAGACCTGTTCCAAGGGCACTGGGACGCCGACT
CGCGCTGGCTGCAGTTTGCGGCGCTTCACTTTGACGTCTCCATGCTCGAGCAGTACTGGAGTTGGGCAGTGGGCA
TCACGGTCGTGTCCGCGCCCCGAGATCTGATCCTGGACGACCTCGCCGGGGCAGTTAGGAGGCTCGGCATCACCC
ATGTCGACCTCACCCCTAGTCTGGCCCGGCTGACGAGTCCTGAGGAGATGCCGAGTCTGCGCGTCTTCATCACGG
GAGGAGAGCAACTGAAGCAGGAGATTCTCGATAAATGGGGCCCAAAGGCCGTCATCTACAACGCCTACGGCCCTA
CGGAGGCGACCATCGGCGTGACCATGTGTCCGCGCGTGCCCGTCAACGGACGCCCGAGCAACATTGGTAAACAGT
TTCTCAATGTCGGCTCTTACGTCTTTCGTCCATTGACCGAGACTCCTGTCCTACGAGGTGCCGTCGGGGAGCTGT
GCGTGTCAGGCAAGCTGGTGGGCAAGGGATACCTGCGCCGTCCAGAGCTCACCAAGGAGCGGTTCCCGACGCTCG
TCGAGTTTGGTGAAAGGGTCTACAGGACGGGCGACCTGGTGCGGATCCTCCACGACGGATGCTTTGAGTTTCTTG
GCCGCGCAGACGATCAGATCAAGTTGCGCGGACAGCGGCTGGAGATGGGCGAGATTAACCACGCAATCCGCTCAG
GGGCGGCGGGCGTTCTCGATTGTGCAACGCTCTTGGTGCACAGAGAGACTCCGGACAAGGATGTCTTGGTGTCCT
TTGTTGTCGGACGGGCGTCAACCGGCCGTCAAAGGCTCTCCACGTTGCAAGACCCCGACGGACTTGGTGCTCAAG
CAAGAACGGCTTGTCTTGGGAGGCTGCCGGCCTACATGGTGCCAACATATTTCCTCCGGCTGCCGTACATACCTC
TCTCGCCGAACAACAAGGTCGAAGCTAAAGAGCTCAAGTCGTTGTTTCAGTCTCTCTCGCATGAGGAGCTGATGA
AGCTGTCGGCCGCTGCTGTGGCTCTCCCGACGAGCCTCGACGAGGCCGGCACTGGCAGCATCATCAGCATCGTGT
CCGAGTTTAGCGGCGTCGCAGAAGACAAGTTCACGCCGTCGACCAGCCTGTTCGACGTCGGCGTGGACTCCATCA
CCGCCCTGCAATTGACCGCCCGGCTTCGCGAACGAGGTTTCCGGGCTGCCTCTCCCGCTGTGTTGCTGAAATGGC
CCATCATCGCGCACCTCGTCAAAGCCCTGGCCGACAACTCCTCAGAAGTAGCAAGCATCATGGTTAGCGGTGTGA
GGGAAGCTAAACAGCTCCTGCAGGCCTGTCACTACAGATATCTCCCATTCGTGTGCCGCGAGCTGGACGTGGGGC
CTGATGAGGTTGAATATATTGCGCCGTGCTCGCCGCTGCAACAGGGCATCATCTTCAAAGCTCTCAGTAACGAGA
GCTCCGACCCTTACTTTTCCTCTTTCGAGCTGAGACTGGATAGAGGCGCCTCGGTTGACAGAGTCCGCGACGCCT
GGAGTCGGACTGTTGATGCTCACGCCATACTTCGATCTGTTTTTGTCAACACCCCTGATGGGCATATTCAGGTCG
CAATGCGTCAGACAAAGGGTCAATGGCAAGACGTGAAATTTGAATCTCAAGACGAACTCTTTCTCACCATGGAAA
CGAAAAGGCGAGATTGGGTTGCGAAAAACAGGCATCACTTTGGCCGCCCCATCGAGCTCATTCACGCGCAGGGGC
CGGACTCTCAGAGGCTCTTCCTCCACATCTTCCATGCGCTCTACGACGGCAGCAGCTTGCGACTCATCAGCCACT
ATGCCAAGGCCCTGTACCGCGACGAGCAACCGCCGTCAAGCCCCCCATTTATCGAGGCCTTGAGCCACGGGCCGC
TCTCAAGACACGATCAGTGCCGACAGTTTTGGACGGAGCACATGCGTGGCTGGACACCGTCACCAGTGCCGACGC
TCGCAGCATCGTCAGACGAACTCAGAGGCGTGACAGTCAGTCGCAACGTTCCGCTGGCCCTACTCGAGGGGCTGC
GACGTCAACAAAACGTCACGATGCAGTCTGTCGTGCTCGCCCTGTGGACTTCGGTCCTCCAGAGATGTCTGACCA
GCAGCGTCACAGTTGGCGTCATTCTTTCAGGCAGGTCTATTGACCTTGCTGGGGTCGAGCGGACAATCGGCCCTC
TGTTCAACACCGTGCCCTTCTTCGTCGACGCCCTGCGAGAGCGCACTTGGTCGTCGTTGATCCGCGAGGCCCATG
GCTTCAGCACTTCGGTAATGCCTTTCCAACATGTGCCCCTGAAGGACATCCAGTCATGGTGCTCTGGAGGCCGTC
CGCTTTTCGACAATCTCTTTGTGTTCCAGCTTGAACAGCCTGAATGGTGCGACGAAGCTGCGCTTTGGGAGGTCG
AAGACGGTCCGGATCGCCCCGATTACCCCCTGGCGCTCGAAGCGACGCGAACATTAGGGGGGAACTTACGGCTAT
GCCTTGTGTCGCAAAGCCGGTATGCTGATGCAGTCATGCTGGAGGGCATGCTGGACCAATTCGAACAGGTGATGG
CGACAGCCGAGGCGGAGGCAACGGGGAGTCCTTGGCAAGGCGCTACAGAGCCCAATCAGGGGGTGTTAGTCGGGA
ACTCTGGAGAGGAAGAGGCGGAGGTCATGTTCGACTGGACGGAGGAAGCTGTTGTGGTGAGGAATGAGTTGGCGC
TACTTGCCCGCATACCCCCTGAACAAGTCGGCGCAACAACTATGCTGCTGGAGCTGGGCCTTGACAGCATTGATG
CGATGAAGCTCTCAACAAGGCTGAAGCAGCGTGGAATCAACGTATCTGCGTCAAACATACTGCGAAGCCAGACGA
TAGCCCGTCTCGTTGGTCAGCTGGAGATGAGCGGCGTTGCGCTTCCATCCAACTCTGAGTCTTCGAAACTCCTCG
AAGAGATAAGATCTAGGCTCTGGATCGAGGTAGAGAATGGTGTGACAGACGCGAAAATGGTTGAGTCGGTCTTGC
CTCCGACTCCTCTCCAGGAAGCCATGGTTTCGGGCATGGTTCAGTCAGGCTTTCAGTGGTACTTCAACCACGATA
TCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTTGGTGCCGCGTGGAGGCAGCTGATCGAGGCATCGCCAT
GCTTGAGAAGCGGCTTCATCGAAGTTGGCGACTCGAATCTGGACGTGTCGTACTGCCAAGTCACCTTCAAGAGCA
GAACTTGTTGCGTCAAGACGCGGGCGCTGGCGGACAAGTCTGAGATGGGACAGGTGATGCTGGACGCGACGCGGC
TGGCTGCTCAAAGCAAGGGACTGCAAGACTTGGTGCAGATTGCGCTGGTGACGGTTGGCGAGCGACGTCTCGTTG
TCGTTTCCATGGCTCATGCTCTCTACGACGGTTGGTCGCTCGGGCTCATGTATCGGGATCTGGAAGAGCTGTACT
GGGGGCGGGAGAGGAAGACACAACAAACATCCACCGATGCTTTTGTTGGGCGCGTTCTGGCCTGCAGGACGGAAG
AGGCCCGCGGTTTCTGGACTGGTCATCTCGCGGGCCTTCGGCCGACTTTGTTGACAGGAAGGGCGAAGACGACAA
CGAAAACAGGAGACTGGCCGTTGCGCAAAGAAGCTCCGTCCGGCTGCAGTCTCTCTCAACTAACAAGCTTCTGCA
AGAGGCAGGCAATCAGTCTACAGGTGCTCTGCGTCGCCACATGGGCTGTCGTCGTGGCGGAGCGAACCAGGGGCC
TCGATGTCGTCTTCGGACTCGTGCTGTCTGGCAGAGACGGAGAGGGGACGGAGGAGCTGATGTTGCCGACCATGA
GCACAGTGGCCTTGCGCTGCGTCCTTCACGGCTCCGTCTCCAGCTTCCTCAAATATGTGGAGGAGACGGTGACGG
ATGTCAGGGGCTATCAGCATTACCCCCTGCGCAGGGTTCAAGCTGCGGAGGCCTTTAACTCGCTTTTCCTATTCC
AAAAGACGCCCAGACAGAATGAGGCGTCGACCCGGCTGTTTCGGTCCATCGACGGCCAGTCAGCTGTCGAATATC
CGGTCTGTGTCGAGGCCGAGCCCGTCGACGATGGACTTGTTTGGCGTGTCGCCTGCCACCGACAACTCTTCTCCA
GCCAAGACACCCAGCTGCTACTCAGTAGGTTGGATCAGGTGCTACAGTACATGTTTGACCACGAGGCCATTGCTG
TCCTCTCCTTCGAGGATGAGGGCGTGTCGATTTGCGGGCTGCCGGTGCTGGAGGTCGAGGAAGGGCGTGTCCTCG
ACTGCCGGCCCGACGTGACCGACGACCAGCCAAGCGAGCAGGAAACCTGGGGAGACACGGCTACTGCAATTCGCC
ATGTCTTGAGCCAGGTTTCGGACATGCCAGTCGAGTCGATAACGCTTCGATCCAGCCTGTACCAGCTCGGCCTCG
ACTCCATCAGTGCCGTCAAGGTGTCGATGCTACTCCGCAAGAGAGGAATCGAACTAAAACCGAGGCAGCTCGTCA
AGCTGTCGAGCTTGAGGGAAATGGCAGACAACGTGACGCTCGCAGGACAAGACACTAAGAAGCAGAAGTCCCATC
CGGGAGTGACGTGGAAGCCCCCTAGGTCCATGGACGTGGACGAGCTGCTCCGAGAGTGTAACGTGCCGAGAGACT
GCGTCGAGGCGGTGCTGCCAGCGACGCCGATGCAGGCGTACATGCTGACGGCATGGGAGAAGCCAGGCGGCGCCG
TCTTCTTCCCAGAGTTTCACTACCGTATGGACGGCACTGATGACGTGTTGAGGGCCCAAGAGGCATGGAAGATGC
TCAGCGACCAGACGGCCGTGCTGCGAACACGCTTCTTGGCCACCGGCTTTGATGAGGTACCGTGGATCCAGGCGG
TGATGCACAAGGAGGCCATCCGATCCGGCCGCATATCACAGCCCCTGGTCCGTCTCGACATCAACAAGGCCGACT
CGGGCAAGGGACTGGAGCTGCGACTCAAGATACACCATGCCCTGTATGATGAACTCAGCCTGGCAGCCCTGACTT
CGCAGCTGTGCGAGCTTGTGAACAGCACGGCAGCCCCTGAGAGCGACGACGACGACGACGACGACGACGACGACG
ACGACGGTTTCTCACGGTGGGCGCTCTACTGCAATGCTCTGCCGGACGGCCGGGCCAGACGGCGAGAGTTCTGGA
CCGAGTATTTGAGGGGAGGCACCGCCGTCGACATTGAAGCGTCTTCGGCGACCGACACGGCCGAGAGAGCGTCCT
ACCTCGACAAGTCAGCCGTGAACGACGTGACGGATCTACGGGCAACGGCCTCACAGCACAGCATAAGCCTGCAAG
CACTCGTCTTAGCCGCGCTGGCGAAGAGCCTGGCCGGACGAGACTCGGAGCGTGCAATCATCCTGGGCATCTACC
TCGCCAACCGAGCCGGCGGCGAACGAGACTCGCCACCTGCGACGTGTCCGACGCTCAACCTAGTGCCGGTCAAGG
TGCAGCCAAGTCCGGGCCTCCGTCTTGTCGACATGGCGAGGGCGATTCAAGCCGATGTCGTCAGCATAGGCGACG
ACGGACGAGCCCAAGTCGGGCTCTGGGAGATTCTGGCCTGGACGGGCGTCCGGATCGGCTGCTTCGTCAACTTTC
TCGTCGGCGGCGCCAAGGTGGACCGCGTCGGGGATGTCGTCACTCTCCGTTCCGTACAAGGAGACGTCATGCCCA
TCATGGTGATGGGAGAAGCGTCGCCGCGCGGGCCCAGGAGGAACGTGGTTAGCGACGCGGTCGAGGTGAGATTTT
CTTCTCTTCTTCTTCTTCTCCTTCTTCTCCTTTTTCTTCTTCTTCTCCTTCTTTCGACCGTTTCAAATGCAGAGC
CTCGCTAAACGACGAAAAAAATAAAAATAAAAAACAATAGCCTTCGGTCGACATCGAGGCCTCGGTCAGCGGGGA
CAAGGCTCTCGCCGTCGGAGTCTTTGGCCCGAGGGGGCGCGTGACGGACGAGTGGGCCGCCAAGCTGGTTGCCGA
TACGGTTGCGTTCCTGGCCGAGGCGGGCGCGGGCGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail