Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1454
Gene name
Locationscaffold_150:155..14895
Strand-
Gene length (bp)14740
Transcript length (bp)14427
Coding sequence length (bp)14424
Protein length (aa) 4808

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 1.6E-68 31 421
PF00501 AMP-binding AMP-binding enzyme 1.6E-73 1028 1421
PF00501 AMP-binding AMP-binding enzyme 3.0E-79 2651 3047
PF00668 Condensation Condensation domain 1.6E-20 737 925
PF00668 Condensation Condensation domain 4.3E-24 1658 1998
PF00668 Condensation Condensation domain 7.7E-33 2205 2617
PF00668 Condensation Condensation domain 1.5E-28 3294 3689
PF00668 Condensation Condensation domain 3.6E-27 3836 4233
PF00668 Condensation Condensation domain 1.1E-08 4475 4688
PF00550 PP-binding Phosphopantetheine attachment site 3.7E-04 536 597
PF00550 PP-binding Phosphopantetheine attachment site 4.0E-08 1555 1617
PF00550 PP-binding Phosphopantetheine attachment site 2.8E-08 2101 2162
PF00550 PP-binding Phosphopantetheine attachment site 8.0E-08 3183 3245
PF00550 PP-binding Phosphopantetheine attachment site 4.4E-09 3732 3793
PF00550 PP-binding Phosphopantetheine attachment site 7.9E-10 4285 4347

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2099 4227 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2044 4679 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 45 2061 6.0E-159
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 40 1979 3.0E-152
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 62 2060 5.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2099 4227 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2044 4679 0.0E+00
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 45 2061 6.0E-159
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 40 1979 3.0E-152
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 62 2060 5.0E-148
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3 2035 4.0E-142
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 504 2571 1.0E-129
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 42 1804 3.0E-129
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2092 3684 6.0E-127
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 47 2069 2.0E-124
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2083 4140 1.0E-123
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 42 1812 3.0E-123
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 42 2143 2.0E-122
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2062 3639 5.0E-117
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 45 1983 3.0E-114
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 979 2577 3.0E-112
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 22 1695 3.0E-112
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 20 1616 2.0E-111
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 47 2005 8.0E-111
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 45 1726 2.0E-110
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 45 1726 4.0E-110
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 47 1984 4.0E-110
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 43 1835 1.0E-108
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 47 1621 5.0E-108
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 77 1909 7.0E-108
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 42 2104 2.0E-106
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 47 1811 9.0E-106
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 985 3039 4.0E-105
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 29 1984 4.0E-105
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2096 3626 1.0E-104
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 42 1796 2.0E-104
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 77 1615 3.0E-104
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 1619 1.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 15 1818 2.0E-103
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 47 1717 3.0E-103
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2086 3605 1.0E-102
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 47 1520 4.0E-102
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 47 1984 6.0E-102
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 47 1814 1.0E-101
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1024 2471 7.0E-101
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 1683 1.0E-99
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 77 1526 1.0E-99
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 47 1809 1.0E-97
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2197 3795 4.0E-97
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 45 1622 1.0E-96
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 45 1516 5.0E-96
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 1024 2043 2.0E-95
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 77 1968 2.0E-94
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 77 2064 4.0E-94
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 2566 3687 8.0E-94
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2644 4126 9.0E-94
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2164 3619 1.0E-89
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2192 3730 2.0E-89
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 636 2080 1.0E-88
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1058 1925 2.0E-88
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2082 3569 3.0E-88
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 40 925 1.0E-84
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2390 3693 1.0E-83
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2203 3622 3.0E-83
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2199 3567 8.0E-83
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2195 3795 8.0E-83
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2190 3572 2.0E-82
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2201 3795 8.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1022 2079 9.0E-82
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2088 3361 2.0E-81
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2096 3607 4.0E-81
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 737 2064 8.0E-81
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 633 2073 2.0E-80
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2069 3584 8.0E-80
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2081 3622 2.0E-79
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2199 3622 8.0E-79
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 47 928 1.0E-78
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 633 2045 4.0E-78
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 636 1984 6.0E-78
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 631 1984 7.0E-78
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 737 1984 2.0E-77
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 90 1622 2.0E-76
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2333 3852 6.0E-76
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 754 1982 2.0E-75
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 751 2054 4.0E-75
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2204 3622 1.0E-74
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 631 1983 9.0E-74
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 90 967 1.0E-73
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1056 1988 1.0E-73
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2148 3571 2.0E-73
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2088 3619 4.0E-73
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 46 926 5.0E-73
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2557 3684 9.0E-73
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 635 1984 3.0E-72
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 754 2051 4.0E-72
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2071 3584 5.0E-72
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2199 3604 5.0E-72
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 634 1983 5.0E-72
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2197 3622 8.0E-72
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2679 3631 2.0E-71
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 2096 3358 4.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2066 3622 6.0E-71
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2234 3687 1.0E-70
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2073 3150 1.0E-70
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2096 3435 2.0E-70
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 635 2059 4.0E-70
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 636 1998 5.0E-70
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 680 1984 6.0E-70
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2202 3636 7.0E-70
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2062 3609 1.0E-69
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 2199 3253 1.0E-69
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2578 3568 2.0E-69
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 677 1804 2.0E-69
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 2199 3816 2.0E-69
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2062 3609 4.0E-69
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 2646 3442 6.0E-69
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 1010 1808 2.0E-68
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2199 3444 3.0E-68
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2096 3625 4.0E-68
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2202 3243 6.0E-68
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 752 1983 1.0E-67
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 22 914 4.0E-67
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2096 3604 5.0E-67
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2047 3648 5.0E-67
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2062 3609 1.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2188 3250 2.0E-66
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2096 3619 2.0E-66
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 579 1988 3.0E-66
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2096 3619 3.0E-66
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1058 1964 4.0E-66
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2176 3248 4.0E-66
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 1058 2007 5.0E-66
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 2646 3609 7.0E-66
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 2646 3609 7.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 738 2067 7.0E-66
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 43 948 8.0E-66
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2197 3622 1.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2047 3253 1.0E-65
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2074 3622 2.0E-65
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1049 2143 2.0E-65
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2096 3622 3.0E-65
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1058 2064 3.0E-65
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 728 1809 6.0E-65
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1049 1982 8.0E-65
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 21 597 9.0E-65
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2047 3253 1.0E-64
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2197 3619 4.0E-64
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1779 3627 5.0E-64
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 636 1628 7.0E-64
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2096 3622 7.0E-64
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 35 915 8.0E-64
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 1024 2061 1.0E-63
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2103 3216 2.0E-63
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2230 3622 3.0E-63
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2199 3261 3.0E-63
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 2646 3609 3.0E-63
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 915 1984 5.0E-63
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 2405 3640 5.0E-63
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 1056 2099 6.0E-63
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 1058 1879 7.0E-63
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 1058 1879 8.0E-63
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 2117 3389 1.0E-62
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2170 3627 1.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2069 3622 1.0E-62
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 678 1989 2.0E-62
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 1056 2099 2.0E-62
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 77 1008 2.0E-62
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2099 3250 2.0E-62
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1058 1984 3.0E-62
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 954 2052 5.0E-62
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 636 1516 7.0E-62
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 756 1988 9.0E-62
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 966 2143 1.0E-61
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 2646 3571 1.0E-61
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 11 599 2.0E-61
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 1028 1980 2.0E-61
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 754 1645 3.0E-61
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1022 2050 3.0E-61
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2097 3262 4.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1028 2064 5.0E-61
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 634 1622 6.0E-61
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 2105 3155 7.0E-61
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 2098 3360 1.0E-60
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2096 3622 2.0E-60
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 2210 3622 2.0E-60
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 2210 3622 2.0E-60
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2300 3622 3.0E-60
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 2230 3622 3.0E-60
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 45 947 3.0E-60
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 2617 3261 3.0E-60
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 67 994 4.0E-60
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 2617 3261 4.0E-60
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 143 1627 5.0E-60
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 1024 2066 7.0E-60
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 2647 3626 7.0E-60
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 1024 1972 1.0E-59
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2088 3400 2.0E-59
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2646 3622 3.0E-59
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1056 2099 3.0E-59
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1058 2007 4.0E-59
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 737 1626 5.0E-59
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 2639 3452 9.0E-59
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2199 3360 1.0E-58
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2098 3254 1.0E-58
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2646 3624 2.0E-58
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 956 1641 3.0E-58
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 756 1984 4.0E-58
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2102 3217 4.0E-58
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2676 3687 4.0E-58
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 2197 3687 4.0E-58
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 12 947 5.0E-58
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 2649 3568 6.0E-58
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2676 3687 7.0E-58
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 77 596 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 511 2.0E-57
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2031 3251 2.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 1058 2007 2.0E-57
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2228 3305 2.0E-57
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2679 3807 3.0E-57
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2638 3692 3.0E-57
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 961 1713 6.0E-57
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2097 3687 1.0E-56
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 2240 3223 1.0E-56
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2676 3680 2.0E-56
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2646 3484 2.0E-56
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 38 926 2.0E-56
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2093 3353 3.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1028 1983 3.0E-56
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1028 1983 4.0E-56
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 2679 3690 5.0E-56
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 1053 2035 6.0E-56
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2097 3622 9.0E-56
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1058 2069 9.0E-56
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 56 804 2.0E-55
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 2674 3226 2.0E-55
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1028 1810 2.0E-55
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1028 1522 3.0E-55
sp|P09095|TYCA_BREPA Tyrocidine synthase 1 OS=Brevibacillus parabrevis GN=tycA PE=1 SV=2 47 598 3.0E-55
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2099 3249 4.0E-55
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 45 942 4.0E-55
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 47 776 4.0E-55
sp|P0C062|GRSA_BREBE Gramicidin S synthase 1 OS=Brevibacillus brevis GN=grsA PE=3 SV=1 47 598 5.0E-55
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 2644 3252 8.0E-55
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2097 3257 1.0E-54
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 847 1622 2.0E-54
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 45 916 2.0E-54
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 47 950 2.0E-54
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 45 916 3.0E-54
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1028 1617 3.0E-54
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 47 950 4.0E-54
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2120 3222 4.0E-54
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 757 1464 4.0E-54
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 2096 3255 5.0E-54
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2646 3681 5.0E-54
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 1028 1964 5.0E-54
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2199 3149 6.0E-54
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 41 599 1.0E-53
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 45 916 1.0E-53
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 2679 3251 3.0E-53
sp|P0C061|GRSA_ANEMI Gramicidin S synthase 1 OS=Aneurinibacillus migulanus GN=grsA PE=1 SV=1 47 598 3.0E-53
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 2701 3640 6.0E-53
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 737 1849 1.0E-52
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 77 823 1.0E-52
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 47 511 1.0E-52
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 46 599 2.0E-52
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 22 928 2.0E-52
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 22 928 2.0E-52
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 78 986 3.0E-52
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1545 2497 4.0E-52
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 45 939 4.0E-52
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 42 598 5.0E-52
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 13 511 8.0E-52
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 2197 3625 1.0E-51
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 42 926 1.0E-51
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 2679 3584 1.0E-51
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1058 2069 1.0E-51
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 2244 3352 2.0E-51
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 1058 1983 3.0E-51
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 733 1522 3.0E-51
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 2637 3243 3.0E-51
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 41 916 4.0E-51
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2678 3611 4.0E-51
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 2590 3226 4.0E-51
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 42 650 5.0E-51
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 2096 3451 9.0E-51
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 2646 3810 1.0E-50
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 21 600 2.0E-50
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 2676 3627 2.0E-50
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2416 3382 2.0E-50
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 2646 3092 2.0E-50
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 1058 1616 3.0E-50
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1056 1968 4.0E-50
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 733 1522 4.0E-50
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 42 598 5.0E-50
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 42 926 5.0E-50
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 31 597 8.0E-50
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 11 913 1.0E-49
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 2666 3358 1.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1036 1622 2.0E-49
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 2195 3247 2.0E-49
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 80 608 2.0E-49
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1056 1798 3.0E-49
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 21 511 3.0E-49
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 1056 1964 3.0E-49
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 1056 1796 5.0E-49
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 753 1522 5.0E-49
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 42 511 9.0E-49
sp|Q9L9G0|NOVH_STRNV Novobiocin biosynthesis protein H OS=Streptomyces niveus GN=novH PE=1 SV=2 45 511 1.0E-48
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 957 1707 2.0E-48
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 957 1707 2.0E-48
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1058 1829 3.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 23 513 5.0E-48
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 45 511 6.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 754 1692 9.0E-48
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 77 595 1.0E-47
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 1056 1628 2.0E-47
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 22 822 2.0E-47
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 42 777 5.0E-47
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 45 923 5.0E-47
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 47 511 1.0E-46
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 11 599 2.0E-46
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 45 599 3.0E-46
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 21 511 3.0E-46
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 77 599 5.0E-46
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 2096 3250 8.0E-46
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1058 1798 9.0E-46
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 47 776 1.0E-45
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 43 917 1.0E-45
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 43 917 1.0E-45
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 78 598 1.0E-45
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 960 1931 1.0E-45
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 42 915 2.0E-45
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 21 511 5.0E-45
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 1054 1522 7.0E-45
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 41 847 8.0E-45
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2122 3074 1.0E-44
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1045 1520 2.0E-44
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 45 511 2.0E-44
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1028 1620 2.0E-44
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2060 3224 3.0E-44
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 2060 3224 3.0E-44
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 21 511 3.0E-44
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 42 511 4.0E-44
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 2677 3151 7.0E-44
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 42 511 1.0E-43
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 2677 3243 3.0E-43
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 2677 3151 3.0E-43
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 2677 3151 3.0E-43
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 2431 3149 5.0E-43
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 2677 3151 5.0E-43
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 2677 3151 7.0E-43
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 2678 3266 8.0E-43
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 45 512 9.0E-43
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 2677 3151 9.0E-43
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2331 3090 1.0E-42
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 2678 3243 1.0E-42
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 2677 3151 1.0E-42
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 2646 3151 2.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 78 641 4.0E-42
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 77 456 8.0E-42
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3725 4715 9.0E-42
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 2701 3256 9.0E-42
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 90 590 9.0E-42
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 90 590 1.0E-41
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 41 592 2.0E-41
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 2677 3151 3.0E-41
sp|Q01757|ACVS_STRCL N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase (Fragment) OS=Streptomyces clavuligerus GN=pcbAB PE=3 SV=1 42 514 5.0E-41
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 41 592 1.0E-40
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 41 592 2.0E-40
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 21 511 4.0E-40
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 84 778 5.0E-40
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 1058 1596 7.0E-40
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 47 513 1.0E-39
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 41 593 3.0E-39
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 78 600 5.0E-39
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 78 600 5.0E-39
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 78 600 5.0E-39
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1056 1620 6.0E-39
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 47 513 9.0E-39
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 47 513 9.0E-39
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 47 513 1.0E-38
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 47 513 1.0E-38
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 2646 3150 2.0E-38
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 75 708 3.0E-38
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 42 573 9.0E-38
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 2677 3149 2.0E-37
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 2700 3264 3.0E-37
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 2677 3149 1.0E-36
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 2701 3248 2.0E-36
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 2701 3248 2.0E-36
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 2701 3248 2.0E-36
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 2717 3151 2.0E-36
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 2679 3149 2.0E-36
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 2646 3622 3.0E-36
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 47 512 3.0E-36
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 2677 3149 3.0E-36
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 2670 3569 4.0E-36
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 1028 1619 1.0E-35
sp|Q4WMK2|NRPS9_ASPFU Nonribosomal peptide syntethase 9 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS9 PE=3 SV=1 41 611 2.0E-35
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 1023 1520 2.0E-35
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 1023 1520 2.0E-35
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 1023 1520 2.0E-35
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 1023 1520 3.0E-35
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 1023 1520 3.0E-35
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 1023 1520 3.0E-35
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 1027 1520 3.0E-35
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 1023 1520 5.0E-35
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 1058 1520 6.0E-35
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 8 786 1.0E-34
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 2660 3151 1.0E-34
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 2660 3151 1.0E-34
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1058 1640 1.0E-34
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 1023 1520 1.0E-34
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 1023 1520 1.0E-34
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 2660 3151 2.0E-34
sp|Q1B6A7|MBTB_MYCSS Phenyloxazoline synthase MbtB OS=Mycobacterium sp. (strain MCS) GN=mbtB PE=3 SV=1 78 594 2.0E-34
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 47 513 3.0E-34
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 47 513 3.0E-34
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 47 513 3.0E-34
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 2660 3151 3.0E-34
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 2643 3149 3.0E-34
sp|P29698|ENTF_SHIFL Enterobactin synthase component F OS=Shigella flexneri GN=entF PE=3 SV=2 1058 1633 4.0E-34
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 2660 3151 4.0E-34
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 2643 3149 4.0E-34
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 90 913 6.0E-34
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 2561 3292 6.0E-34
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 88 513 7.0E-34
sp|Q8XBV9|ENTF_ECO57 Enterobactin synthase component F OS=Escherichia coli O157:H7 GN=entF PE=3 SV=1 1058 1633 8.0E-34
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 47 513 8.0E-34
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 47 513 8.0E-34
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 47 513 9.0E-34
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 47 513 1.0E-33
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 47 513 2.0E-33
sp|P11454|ENTF_ECOLI Enterobactin synthase component F OS=Escherichia coli (strain K12) GN=entF PE=1 SV=3 1058 1629 2.0E-33
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 47 513 2.0E-33
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 47 513 2.0E-33
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 2643 3149 2.0E-33
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 2679 3149 4.0E-33
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 78 598 8.0E-33
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 47 513 9.0E-33
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 1045 1522 1.0E-32
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 1058 1520 2.0E-32
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 1058 1520 2.0E-32
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 1055 1520 2.0E-32
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 1058 1520 5.0E-32
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 2660 3150 7.0E-32
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 2717 3149 1.0E-31
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 2717 3149 1.0E-31
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 2717 3149 1.0E-31
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 41 455 4.0E-31
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 2679 3149 4.0E-31
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 2717 3151 4.0E-31
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 2717 3151 4.0E-31
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 636 1527 5.0E-31
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 2675 3149 5.0E-31
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 2717 3151 6.0E-31
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 2675 3149 6.0E-31
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 1056 1591 8.0E-31
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 1056 1591 8.0E-31
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 533 1408 9.0E-31
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 2675 3149 9.0E-31
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 47 514 1.0E-30
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 87 512 2.0E-30
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 1058 1520 2.0E-30
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 1092 1522 2.0E-30
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 2717 3159 2.0E-30
sp|Q8Y8D4|DLTA_LISMO D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dltA PE=3 SV=1 1058 1521 3.0E-30
sp|Q65DH1|DLTA_BACLD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dltA PE=3 SV=1 1058 1522 3.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 1058 1520 3.0E-30
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1465 2023 4.0E-30
sp|Q81G39|DLTA_BACCR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dltA PE=1 SV=1 1024 1520 4.0E-30
sp|B7HHC6|DLTA_BACC4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain B4264) GN=dltA PE=3 SV=1 1024 1520 4.0E-30
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 45 609 4.0E-30
sp|C1L1P5|DLTA_LISMC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dltA PE=3 SV=1 1058 1521 4.0E-30
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 47 514 4.0E-30
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 2702 3152 4.0E-30
sp|B8DEG2|DLTA_LISMH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dltA PE=3 SV=1 1058 1521 5.0E-30
sp|Q721J2|DLTA_LISMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dltA PE=3 SV=1 1058 1521 6.0E-30
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 2717 3149 6.0E-30
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 78 595 8.0E-30
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 2717 3149 8.0E-30
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 2717 3149 8.0E-30
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 2676 3149 9.0E-30
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 1058 1520 9.0E-30
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 78 791 1.0E-29
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 78 791 1.0E-29
sp|A7GMR0|DLTA_BACCN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|B7HK95|DLTA_BACC7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH187) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|B9IUW2|DLTA_BACCQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain Q1) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|Q81T97|DLTA_BACAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|C3LAH8|DLTA_BACAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|C3P4I7|DLTA_BACAA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus anthracis (strain A0248) GN=dltA PE=3 SV=1 1024 1520 1.0E-29
sp|Q6HLH7|DLTA_BACHK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|C1EM80|DLTA_BACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain 03BB102) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|B7JFV5|DLTA_BACC0 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain AH820) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|A0RBJ0|DLTA_BACAH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus thuringiensis (strain Al Hakam) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|Q63E02|DLTA_BACCZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ZK / E33L) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|Q73BD2|DLTA_BACC1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|A9VKV6|DLTA_BACWK D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus weihenstephanensis (strain KBAB4) GN=dltA PE=3 SV=1 1024 1520 2.0E-29
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 2576 3152 2.0E-29
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 1058 1520 2.0E-29
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 2675 3149 3.0E-29
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 2675 3149 3.0E-29
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 2633 3256 3.0E-29
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 2717 3149 4.0E-29
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 2580 3267 4.0E-29
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 2646 3224 5.0E-29
sp|B7IN64|DLTA_BACC2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus cereus (strain G9842) GN=dltA PE=3 SV=1 1053 1520 7.0E-29
sp|Q92D47|DLTA_LISIN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dltA PE=3 SV=1 1058 1521 7.0E-29
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 1058 1520 7.0E-29
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 1058 1520 7.0E-29
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1028 1463 1.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 1496 1931 2.0E-28
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 1058 1522 2.0E-28
sp|P0DA65|DLTA_STRPQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dltA PE=3 SV=1 47 511 2.0E-28
sp|P0DA64|DLTA_STRP3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dltA PE=3 SV=1 47 511 2.0E-28
sp|P39581|DLTA_BACSU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus subtilis (strain 168) GN=dltA PE=1 SV=1 88 511 2.0E-28
sp|A7ZA74|DLTA_BACMF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dltA PE=3 SV=1 88 511 2.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 1097 1520 2.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 1097 1520 2.0E-28
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3711 4275 3.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 1097 1520 3.0E-28
sp|Q8VM67|DLTA_STRA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dltA PE=3 SV=2 79 513 3.0E-28
sp|A2RE45|DLTA_STRPG D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q1JGF0|DLTA_STRPD D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q8P0J9|DLTA_STRP8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q1JLB7|DLTA_STRPC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q5XBN5|DLTA_STRP6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dltA PE=1 SV=1 47 511 4.0E-28
sp|Q99ZA6|DLTA_STRP1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M1 GN=dltA PE=1 SV=1 47 511 4.0E-28
sp|B5XLX5|DLTA_STRPZ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M49 (strain NZ131) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q1J667|DLTA_STRPF D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|Q48SZ3|DLTA_STRPM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=dltA PE=3 SV=1 47 511 4.0E-28
sp|E2JA29|DDAD_ENTAG Dapdiamide synthesis protein DdaD OS=Enterobacter agglomerans GN=ddaD PE=1 SV=1 1077 1620 5.0E-28
sp|P59591|DLTA_STRA5 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dltA PE=3 SV=1 79 513 5.0E-28
sp|Q3JZ94|DLTA_STRA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dltA PE=3 SV=1 79 513 5.0E-28
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 1028 1620 5.0E-28
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 2720 3090 8.0E-28
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 957 1620 1.0E-27
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 1028 1635 5.0E-27
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3742 4118 6.0E-27
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 42 777 7.0E-27
sp|Q03AZ2|DLTA_LACC3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain ATCC 334) GN=dltA PE=3 SV=1 92 511 7.0E-27
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 2097 3090 8.0E-27
sp|A0AH92|DLTA_LISW6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dltA PE=3 SV=1 1058 1522 9.0E-27
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 2646 3248 1.0E-26
sp|Q88VM6|DLTA_LACPL D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dltA PE=3 SV=1 84 517 2.0E-26
sp|Q73XY1|MBTB_MYCPA Phenyloxazoline synthase MbtB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtB PE=3 SV=1 969 1619 2.0E-26
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 72 513 3.0E-26
sp|Q4L4U5|DLTA_STAHJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=dltA PE=3 SV=1 47 511 3.0E-26
sp|B3WC77|DLTA_LACCB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus casei (strain BL23) GN=dltA PE=3 SV=1 92 511 3.0E-26
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 2655 3149 4.0E-26
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 1082 1649 7.0E-26
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3742 4362 4.0E-25
sp|Q6W4T3|ANGR_VIBA7 Anguibactin system regulator OS=Vibrio anguillarum (strain ATCC 68554 / 775) GN=angR PE=1 SV=1 2701 3226 4.0E-25
sp|P35854|DLTA_LACRH D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactobacillus rhamnosus GN=dltA PE=1 SV=1 92 511 4.0E-25
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 46 511 4.0E-25
sp|P0DJH0|ANGR_VIBAN Anguibactin system regulator OS=Vibrio anguillarum GN=angR PE=3 SV=1 2701 3226 5.0E-25
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 47 514 1.0E-24
sp|Q8CT93|DLTA_STAES D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dltA PE=3 SV=1 1058 1522 2.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 47 514 2.0E-24
sp|Q2YWQ8|DLTA_STAAB D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dltA PE=3 SV=1 1023 1522 2.0E-24
sp|P68878|DLTA_STAAW D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MW2) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|A8Z1J1|DLTA_STAAT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q6GAZ4|DLTA_STAAS D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MSSA476) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|A6QFE3|DLTA_STAAE D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Newman) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q5HHF2|DLTA_STAAC D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain COL) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q2FZW6|DLTA_STAA8 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain NCTC 8325) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|Q2FIE3|DLTA_STAA3 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain USA300) GN=dltA PE=3 SV=1 1023 1522 3.0E-24
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 1023 1522 4.0E-24
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 1023 1522 4.0E-24
sp|P9WQ63|MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtB PE=1 SV=1 971 1586 8.0E-24
sp|P9WQ62|MBTB_MYCTO Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtB PE=1 SV=1 971 1586 9.0E-24
sp|Q7TYQ4|MBTB_MYCBO Phenyloxazoline synthase MbtB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtB PE=3 SV=1 971 1586 9.0E-24
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3091 3689 1.0E-23
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3732 4473 2.0E-23
sp|Q6GIF6|DLTA_STAAR D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=dltA PE=3 SV=1 1023 1522 2.0E-23
sp|C1CB20|DLTA_STRP7 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain 70585) GN=dltA PE=3 SV=1 31 511 3.0E-23
sp|C1CNE9|DLTA_STRZP D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain P1031) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|P0A399|DLTA_STRR6 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|P0A398|DLTA_STRPN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|Q04HZ7|DLTA_STRP2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=dltA PE=3 SV=1 84 511 3.0E-23
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 94 443 3.0E-23
sp|P0C397|DLTA_STAAU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|P99107|DLTA_STAAN D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain N315) GN=dltA PE=1 SV=1 47 514 4.0E-23
sp|P68876|DLTA_STAAM D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|A5IRB0|DLTA_STAA9 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH9) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|A6U039|DLTA_STAA2 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain JH1) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|A7X0D6|DLTA_STAA1 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dltA PE=3 SV=1 47 514 4.0E-23
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 2096 2513 6.0E-23
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1058 1632 9.0E-23
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 19 514 1.0E-22
sp|Q5HQN0|DLTA_STAEQ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dltA PE=3 SV=1 1058 1522 1.0E-22
sp|C0MBD6|DLTA_STRE4 D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus equi subsp. equi (strain 4047) GN=dltA PE=3 SV=1 79 511 1.0E-22
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3183 3626 2.0E-22
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3703 4227 2.0E-22
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 102 467 2.0E-22
sp|C1CU95|DLTA_STRZT D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain Taiwan19F-14) GN=dltA PE=3 SV=1 84 511 3.0E-22
sp|B8ZQ14|DLTA_STRPJ D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=dltA PE=3 SV=1 84 511 3.0E-22
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2194 3156 6.0E-22
sp|Q00868|ESYN_GIBPU Enniatin synthase (Fragment) OS=Gibberella pulicaris PE=3 SV=2 1100 1463 6.0E-22
sp|P48633|HMWP2_YERE8 High-molecular-weight protein 2 OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=irp2 PE=3 SV=1 1058 1464 7.0E-22
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 2676 3223 8.0E-22
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 2024 2607 3.0E-21
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 47 511 4.0E-21
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3290 3622 5.0E-21
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 955 1620 5.0E-21
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4257 4803 6.0E-21
sp|Q9CG49|DLTA_LACLA D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dltA PE=3 SV=1 1098 1522 6.0E-21
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 548 914 1.0E-20
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3718 4157 2.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 75 572 2.0E-20
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3029 3575 3.0E-20
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1577 2009 3.0E-20
sp|F4K1G2|AEE19_ARATH Putative acyl-activating enzyme 19 OS=Arabidopsis thaliana GN=At5g35930 PE=2 SV=1 2703 3221 3.0E-20
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 2658 3151 4.0E-20
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 1656 2002 1.0E-19
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 2649 3149 2.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3710 4163 4.0E-19
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 1023 1522 4.0E-19
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 1035 1681 5.0E-19
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 1355 1980 7.0E-19
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3264 3622 1.0E-18
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 1656 1986 1.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1656 1996 2.0E-18
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 46 446 2.0E-18
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 44 641 3.0E-18
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 1031 1526 3.0E-18
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3753 4151 4.0E-18
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 3726 4233 6.0E-18
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2031 2543 7.0E-18
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3747 4231 7.0E-18
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 3726 4233 1.0E-17
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 1655 1983 1.0E-17
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3290 3679 2.0E-17
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 1 551 3.0E-17
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 1651 2034 5.0E-17
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 1656 1984 5.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 76 420 7.0E-17
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 2670 3085 7.0E-17
sp|Q4WF61|NRPS3_ASPFU Nonribosomal peptide synthetase 3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS3 PE=2 SV=2 3710 4115 8.0E-17
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 3726 4233 8.0E-17
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 35 511 9.0E-17
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1656 2154 1.0E-16
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 38 512 1.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3732 4228 2.0E-16
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3793 4230 2.0E-16
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 363 926 2.0E-16
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3317 3622 2.0E-16
sp|Q9X2N4|DLTA_STAXY D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Staphylococcus xylosus GN=dltA PE=3 SV=1 1058 1522 2.0E-16
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 1174 1521 2.0E-16
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 3290 3827 3.0E-16
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 170 573 3.0E-16
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 487 914 5.0E-16
sp|Q4L235|ACSF4_HUMAN Acyl-CoA synthetase family member 4 OS=Homo sapiens GN=AASDH PE=1 SV=3 1098 1589 5.0E-16
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1638 1984 6.0E-16
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3291 3622 6.0E-16
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3290 3622 6.0E-16
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 2634 3056 8.0E-16
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1656 2001 1.0E-15
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 1656 1984 1.0E-15
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 21 513 1.0E-15
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 33 515 1.0E-15
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 3747 4233 2.0E-15
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3290 3622 2.0E-15
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3286 3695 2.0E-15
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 2676 3150 2.0E-15
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 40 511 2.0E-15
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 1021 1522 3.0E-15
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 1109 1515 4.0E-15
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3826 4194 6.0E-15
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 35 521 6.0E-15
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3823 4230 7.0E-15
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2982 3622 1.0E-14
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 41 515 1.0E-14
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 2662 3060 1.0E-14
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 532 912 2.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3833 4234 2.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3829 4166 2.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3290 3622 2.0E-14
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3831 4245 2.0E-14
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 3830 4152 2.0E-14
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 2676 3060 2.0E-14
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 38 518 2.0E-14
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3289 3622 3.0E-14
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 3808 4166 4.0E-14
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 1055 1522 4.0E-14
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 1056 1524 4.0E-14
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 1058 1521 4.0E-14
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3827 4170 5.0E-14
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 2679 3622 5.0E-14
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 2793 3161 5.0E-14
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 1177 1541 6.0E-14
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 2677 3155 6.0E-14
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 2677 3155 6.0E-14
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3289 3622 7.0E-14
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 45 527 7.0E-14
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 1058 1521 7.0E-14
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3289 3622 9.0E-14
sp|Q80WC9|ACSF4_MOUSE Acyl-CoA synthetase family member 4 OS=Mus musculus GN=Aasdh PE=2 SV=1 2646 3153 9.0E-14
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1628 1984 1.0E-13
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 1345 1520 1.0E-13
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 2676 3150 1.0E-13
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3289 3622 2.0E-13
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3290 3622 2.0E-13
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 57 518 2.0E-13
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 57 518 2.0E-13
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 1175 1463 2.0E-13
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 41 519 2.0E-13
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 1179 1523 2.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3833 4152 3.0E-13
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 3731 4133 3.0E-13
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1075 2069 3.0E-13
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 41 514 3.0E-13
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 2676 3150 3.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 2669 3090 3.0E-13
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3753 4227 4.0E-13
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 1654 1983 4.0E-13
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 2669 3090 4.0E-13
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 1021 1522 5.0E-13
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 2676 3150 5.0E-13
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 1576 1970 7.0E-13
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 1179 1529 7.0E-13
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 1163 1520 8.0E-13
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 633 926 9.0E-13
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 1656 1988 9.0E-13
sp|Q4WR82|NRPS2_ASPFU Nonribosomal peptide synthetase 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS2 PE=2 SV=1 1523 1990 1.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3833 4152 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3290 3657 1.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1656 1981 1.0E-12
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 1677 2093 1.0E-12
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 80 514 1.0E-12
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 1177 1524 1.0E-12
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 1058 1522 1.0E-12
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 47 526 1.0E-12
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 1171 1524 1.0E-12
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 2676 3150 1.0E-12
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 2679 3155 1.0E-12
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 3203 3622 2.0E-12
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 1655 2067 2.0E-12
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 2676 3150 2.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3342 3609 3.0E-12
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 3289 3605 3.0E-12
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 2626 3057 3.0E-12
sp|Q4WYG2|NRPS5_ASPFU Nonribosomal peptide synthetase 5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS5 PE=3 SV=2 3732 4231 4.0E-12
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 2676 3150 4.0E-12
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 2676 3150 4.0E-12
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 1177 1527 4.0E-12
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 3831 4186 5.0E-12
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3840 4197 5.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3745 4150 5.0E-12
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 2669 3151 5.0E-12
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 1081 1526 5.0E-12
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 78 513 5.0E-12
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 2676 3150 5.0E-12
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 1179 1525 5.0E-12
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 2676 3150 5.0E-12
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 2676 3150 5.0E-12
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 2676 3060 5.0E-12
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 47 512 5.0E-12
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 47 512 5.0E-12
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 77 516 5.0E-12
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 2676 3150 5.0E-12
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 1058 1522 6.0E-12
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 2676 3150 6.0E-12
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 2676 3150 7.0E-12
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 2676 3150 7.0E-12
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 2676 3150 7.0E-12
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 2676 3150 7.0E-12
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 2676 3150 7.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 3831 4175 8.0E-12
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 2644 3149 8.0E-12
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 2658 3152 8.0E-12
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 47 512 8.0E-12
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 2096 2501 9.0E-12
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 1172 1520 9.0E-12
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 628 926 1.0E-11
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 3724 4162 1.0E-11
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 739 914 1.0E-11
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 1056 1521 1.0E-11
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 77 514 1.0E-11
sp|Q5RG49|ACSF4_DANRE Acyl-CoA synthetase family member 4 OS=Danio rerio GN=aasdh PE=3 SV=1 1098 1525 1.0E-11
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 2676 3150 1.0E-11
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 1179 1525 1.0E-11
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 1056 1522 1.0E-11
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 2676 3150 1.0E-11
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 2676 3150 1.0E-11
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 1179 1521 2.0E-11
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 2676 3150 2.0E-11
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 2676 3150 2.0E-11
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 2676 3150 2.0E-11
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 1175 1527 2.0E-11
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 47 512 2.0E-11
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 47 512 2.0E-11
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 3907 4329 3.0E-11
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3833 4170 3.0E-11
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 45 506 3.0E-11
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 2676 3150 3.0E-11
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 2656 3161 3.0E-11
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 2755 3073 3.0E-11
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 2677 3150 3.0E-11
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 1058 1522 3.0E-11
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 2676 3150 3.0E-11
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 745 926 4.0E-11
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3830 4186 4.0E-11
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2096 2492 4.0E-11
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 2658 3105 4.0E-11
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 1058 1521 4.0E-11
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 2676 3150 4.0E-11
sp|Q4WAW3|FTMA_ASPFU Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS13 PE=2 SV=1 4286 4515 5.0E-11
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 1705 1964 5.0E-11
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 47 514 5.0E-11
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 1179 1525 5.0E-11
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 2676 3150 6.0E-11
sp|B9WZX0|FTMA_ASPFM Nonribosomal peptide synthetase 13 OS=Neosartorya fumigata GN=NRPS13 PE=1 SV=1 4286 4515 7.0E-11
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 739 914 7.0E-11
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 2676 3150 7.0E-11
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 2676 3150 7.0E-11
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 111 512 7.0E-11
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 2676 3060 7.0E-11
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 1655 2064 8.0E-11
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 1656 2012 8.0E-11
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 93 512 8.0E-11
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 2676 3150 8.0E-11
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 2676 3150 8.0E-11
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 2676 3150 8.0E-11
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 2676 3150 9.0E-11
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3822 4230 1.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1654 1992 1.0E-10
sp|Q4WYP0|NRPS6_ASPFU Nonribosomal peptide synthetase 6 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS6 PE=3 SV=1 3739 4118 1.0E-10
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 2799 3153 1.0E-10
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 2676 3150 1.0E-10
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 2676 3150 1.0E-10
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 1179 1526 1.0E-10
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 1179 1525 1.0E-10
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 2676 3150 1.0E-10
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 2615 3007 1.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 1179 1527 1.0E-10
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3745 4329 2.0E-10
sp|P39846|PPSB_BACSU Plipastatin synthase subunit B OS=Bacillus subtilis (strain 168) GN=ppsB PE=1 SV=1 3833 4168 2.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 2801 3159 2.0E-10
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 1179 1527 2.0E-10
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 1170 1522 2.0E-10
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 1170 1522 2.0E-10
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 2791 3156 2.0E-10
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 143 511 2.0E-10
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 1655 2054 3.0E-10
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 2646 3153 3.0E-10
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 78 506 3.0E-10
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 1167 1522 3.0E-10
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 1154 1525 3.0E-10
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 111 513 3.0E-10
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 1168 1527 3.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 510 926 4.0E-10
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 1058 1524 4.0E-10
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 1058 1524 4.0E-10
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 2658 3105 4.0E-10
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 166 519 4.0E-10
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 1085 1521 4.0E-10
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 1058 1521 4.0E-10
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 3840 4151 5.0E-10
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 3833 4170 5.0E-10
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 2619 3090 5.0E-10
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 1175 1527 5.0E-10
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 19 514 5.0E-10
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 1175 1527 5.0E-10
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 3745 4339 6.0E-10
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 47 506 6.0E-10
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 2796 3155 7.0E-10
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 4300 4524 8.0E-10
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 1179 1525 8.0E-10
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 1056 1523 8.0E-10
sp|Q9P7T1|SIB1_SCHPO Hydroxamate-type ferrichrome siderophore peptide synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sib1 PE=1 SV=1 4269 4664 9.0E-10
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 745 926 9.0E-10
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 2673 3067 9.0E-10
sp|O43103|SID2_USTMA Ferrichrome siderophore peptide synthetase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SID2 PE=3 SV=2 3183 3608 1.0E-09
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3745 4262 1.0E-09
sp|Q4WMJ7|NRP10_ASPFU Nonribosomal peptide synthetase 10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS10 PE=1 SV=1 3672 4126 1.0E-09
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 1174 1522 1.0E-09
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 1174 1522 1.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 2752 3083 1.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 2796 3085 1.0E-09
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 3863 4169 2.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3109 3435 2.0E-09
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 3858 4195 2.0E-09
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 1058 1521 2.0E-09
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 1032 1522 2.0E-09
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 1039 1522 2.0E-09
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 2716 3073 2.0E-09
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 1039 1527 2.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 3745 4147 4.0E-09
sp|A1DA59|FTMA_NEOFI Nonribosomal peptide synthetase 13 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NRPS13 PE=3 SV=1 4284 4515 4.0E-09
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 3840 4151 4.0E-09
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 1174 1522 4.0E-09
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 1174 1522 4.0E-09
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 1058 1515 4.0E-09
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 2766 3083 4.0E-09
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 166 519 4.0E-09
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 2638 3060 4.0E-09
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 745 954 5.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3870 4228 5.0E-09
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 169 513 5.0E-09
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 130 514 5.0E-09
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 1056 1527 5.0E-09
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 2678 3150 5.0E-09
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 2801 3096 5.0E-09
sp|B2HIN2|FAA26_MYCMM Long-chain-fatty-acid--AMP ligase FadD26 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD26 PE=3 SV=1 78 457 5.0E-09
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 1177 1533 5.0E-09
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 77 513 6.0E-09
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 77 463 6.0E-09
sp|Q4WZ44|NRPS7_ASPFU Nonribosomal peptide synthetase 7 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS7 PE=3 SV=1 4286 4518 8.0E-09
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 168 512 8.0E-09
sp|Q4WF53|NRPS4_ASPFU Nonribosomal peptide synthetase 4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS4 PE=2 SV=1 2098 2541 9.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 2096 2615 9.0E-09
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 167 513 9.0E-09
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 1058 1521 9.0E-09
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3753 4228 1.0E-08
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 1656 1988 1.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 1058 1445 1.0E-08
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 2800 3085 1.0E-08
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 2801 3150 1.0E-08
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 2658 3150 1.0E-08
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 1177 1527 1.0E-08
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 2796 3062 1.0E-08
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 3753 4228 2.0E-08
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 2782 3056 2.0E-08
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 2658 3090 2.0E-08
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 1171 1522 2.0E-08
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 46 514 2.0E-08
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 1179 1434 2.0E-08
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 1177 1527 2.0E-08
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 2646 3150 2.0E-08
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 2669 3061 2.0E-08
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 627 973 3.0E-08
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 2677 3060 3.0E-08
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 2676 3051 3.0E-08
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 161 513 3.0E-08
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 30 512 3.0E-08
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 168 522 3.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 3832 4187 4.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 3863 4228 4.0E-08
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 65 452 4.0E-08
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 2753 3090 4.0E-08
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 2701 3153 4.0E-08
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 2669 3060 4.0E-08
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 169 514 4.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 1056 1527 4.0E-08
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 158 513 5.0E-08
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 2674 3149 5.0E-08
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 91 513 5.0E-08
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 1166 1522 5.0E-08
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 3948 4238 6.0E-08
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 1146 1514 6.0E-08
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 2672 3051 6.0E-08
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 168 544 6.0E-08
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4275 4659 7.0E-08
sp|P39847|PPSC_BACSU Plipastatin synthase subunit C OS=Bacillus subtilis (strain 168) GN=ppsC PE=1 SV=2 3863 4150 7.0E-08
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 1039 1540 7.0E-08
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 2201 2597 8.0E-08
sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2 3963 4233 8.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 132 519 9.0E-08
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 2701 3156 9.0E-08
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 1656 1988 1.0E-07
sp|Q4WLW8|NRP11_ASPFU Nonribosomal peptide synthetase 11 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS11 PE=2 SV=1 2068 2471 1.0E-07
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 738 918 1.0E-07
sp|Q00869|ESYN_FUSEQ Enniatin synthase OS=Fusarium equiseti GN=ESYN1 PE=1 SV=2 3201 3682 1.0E-07
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 40 519 1.0E-07
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 2698 3160 1.0E-07
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 168 514 1.0E-07
sp|Q6P461|ACSM6_HUMAN Acyl-coenzyme A synthetase ACSM6, mitochondrial OS=Homo sapiens GN=ACSM6 PE=2 SV=3 1058 1425 1.0E-07
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 173 511 1.0E-07
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 1156 1522 1.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 1058 1527 1.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 2674 3058 1.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 627 917 2.0E-07
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 3863 4150 2.0E-07
sp|Q01886|HTS1_COCCA HC-toxin synthetase OS=Cochliobolus carbonum GN=HTS1 PE=1 SV=2 4212 4683 2.0E-07
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 2661 3156 2.0E-07
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 2795 3095 2.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 2701 3156 2.0E-07
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 163 513 2.0E-07
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 163 543 2.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 1172 1520 2.0E-07
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 2801 3156 2.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 1653 1948 3.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 4296 4679 3.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 3833 4166 3.0E-07
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 30 512 3.0E-07
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 1058 1521 3.0E-07
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 47 505 3.0E-07
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 1058 1527 3.0E-07
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 1177 1527 3.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 1173 1434 3.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 2096 2362 4.0E-07
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 3753 4232 4.0E-07
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 2674 3058 4.0E-07
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 80 511 4.0E-07
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 154 705 4.0E-07
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 175 514 4.0E-07
sp|O88561|S27A3_MOUSE Long-chain fatty acid transport protein 3 OS=Mus musculus GN=Slc27a3 PE=1 SV=2 2784 3062 4.0E-07
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 2701 3150 5.0E-07
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 2701 3150 5.0E-07
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 2701 3156 5.0E-07
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 2701 3156 6.0E-07
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 2800 3069 6.0E-07
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 1173 1434 6.0E-07
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 3745 4228 7.0E-07
sp|Q4WLW5|NRP12_ASPFU Nonribosomal peptide synthetase 12 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS12 PE=1 SV=1 3815 4165 7.0E-07
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 2800 3071 7.0E-07
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 47 517 7.0E-07
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 46 522 7.0E-07
sp|B2HIM0|FAA28_MYCMM Long-chain-fatty-acid--AMP ligase FadD28 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD28 PE=3 SV=1 2658 3061 7.0E-07
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 2701 3060 8.0E-07
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 2701 3156 8.0E-07
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 157 525 8.0E-07
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 47 520 8.0E-07
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 2799 3090 8.0E-07
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 80 446 9.0E-07
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 2800 3095 1.0E-06
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 2701 3153 1.0E-06
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 2701 3150 1.0E-06
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 168 519 1.0E-06
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 73 514 1.0E-06
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 2777 3150 1.0E-06
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 2701 3156 1.0E-06
sp|Q973W5|HPCAS_SULTO 3-hydroxypropionyl-coenzyme A synthetase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_07830 PE=1 SV=1 1334 1535 1.0E-06
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 136 547 1.0E-06
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 1058 1463 1.0E-06
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 136 547 1.0E-06
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 41 522 1.0E-06
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 83 446 2.0E-06
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 65 513 2.0E-06
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 73 514 2.0E-06
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 2701 3156 2.0E-06
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 2701 3156 2.0E-06
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 2644 3069 2.0E-06
sp|Q9VLL0|ACSF4_DROME Acyl-CoA synthetase family member 4 homolog OS=Drosophila melanogaster GN=U26 PE=2 SV=3 2793 3061 2.0E-06
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 136 456 2.0E-06
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 136 456 2.0E-06
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 2657 3156 2.0E-06
sp|Q9ES38|S27A5_RAT Bile acyl-CoA synthetase OS=Rattus norvegicus GN=Slc27a5 PE=1 SV=1 9 489 2.0E-06
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 1058 1521 2.0E-06
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 2800 3069 3.0E-06
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 1056 1524 3.0E-06
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 2800 3149 3.0E-06
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 2782 3149 3.0E-06
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 2782 3149 3.0E-06
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 2701 3156 4.0E-06
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 2701 3156 4.0E-06
sp|O60488|ACSL4_HUMAN Long-chain-fatty-acid--CoA ligase 4 OS=Homo sapiens GN=ACSL4 PE=1 SV=2 1043 1202 4.0E-06
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 1175 1532 4.0E-06
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 2701 3156 5.0E-06
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 1390 1522 5.0E-06
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 4291 4664 6.0E-06
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 2799 3098 6.0E-06
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 1373 1522 6.0E-06
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 169 513 7.0E-06
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 1306 1523 7.0E-06
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 168 517 7.0E-06
sp|Q9I4X3|PQSA_PSEAE Anthranilate--CoA ligase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pqsA PE=1 SV=1 1176 1522 9.0E-06
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 2977 3155 9.0E-06
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 1373 1522 9.0E-06
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 78 514 9.0E-06
sp|Q4WT66|NRPS1_ASPFU Nonribosomal peptide synthetase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS1 PE=1 SV=1 636 914 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1454
MAAQGLSIINPRPTRLLGPSLLHQLIAPPSEHLALDQLGQDGKCSYTYRGLHNAAAAIASLLVDVRSSVARSRTP
FVVPVLIPQSSLLCISLLAVLKAGGAFCPLNLDAPRERIKFILNDVSATVVLVSRSTAHLVPAENHVQVIMVDDI
DNGKTSMPTPDHQEPTPEDVAYVMYTSGSTGTPKGVCIPHDAVTQALLAHDRHIPAFSRFLQFAAPTFDVSVFEV
FFPLFRGSTLVTARRDELLDDLPSVLRKMNVDACELTPTVAASLLRRRQNAPALKLLLTIGEMLTLPVVEEFGGS
ETRPSILWAMYGPTEATIHCTLQAALTSESSTGNIGSPLDTVSCFVVEPRASGHDQSAFKVLPQGEVGELAVGGY
QLARGYLNRPEQTASAFITTPYGQVYLTGDKARVTPDGKLECLGRLTSGQVKLRGQRIETGEVEQSALKTPGCHG
AVAAVVDASLVLFCAVDPGTSEDAIATSCSNWLPGFMVPGEIVLMVEFPRLPSGKIDAQKLKSIYQEQKLAEFSE
HDEMVLAEEEVILHVISSVLERQVSKQMTLAFAGVDSLSAIKLASALRLSGFGMSASDMLKLKTVADLCCHIRKR
PMMKLSNHEVFSVSILADWGHILAQNPGLDLAKRNMDDVIPCTSLQTALLAETARDPQLYCNQLEFQVAPGYTVS
DVADAICQVAAENEVLRSGFVSLRGGYAVVLFRDFGTDDNLRVVPQFDESFSFLHPHDFLKPFRVQICNKEKDAG
LRVLFQVHHAVYDGWSMDLILSDLSALLRRVPLSPRPQFREVLRHHLRDFKDVEDDSAMKFWGEHLTGWNKSSFP
KLAAQSPMSNEVQTRSHTLEILPEQVKRMAGEWAVGVQVLFQASLALLWSGIAGEQDMVLGSVTSGRTIAVDQIE
EIVGPCIASLPFRVDLNNMISVKDLLPSESLYDILIVYQESLESLKKQDWLLTEPRESCYRIQATYHSSFFAPGL
VDCLLQQFDDMTGMLLKSPDMCLRSVRSAMPGLSLHNEAVQPFLGVPDLAAQFEATAAAMPTAAALCFCDSFTSL
GPRTLSTSYEELNRAANQVAHYLCSQLIPIGEVLAVLMSKSPTFYTTVLGVQKAGCAYLPILPQTPEVRVRTILK
QAGVKHCLVDNASLPMFSLEGVRIHDVERVEMQRYSPDNRNIPRTASRLAYVIYTSGTTGVPKGVAVTQENIVSN
ITVLRSIYPKPKTAEPRLLQACSQAFDVSVFEIFFAWHAGMCLCAAPNDILFQDLERFMRLLKISHLSLTPTLAS
LIDAAKVPGVEFLVTAGEPMTLSVLDRWHDRLWQGYGPSETTNICSVKHMARGENIEHLGWALPNTSTFVMRTMA
AETVPVGWVGELCFGGHQVAWGYLNDTRLTKEKFVHHPKYGRIYRSGDLGRMLPDGSLVILGRLDDQIKLRGQRI
AAGEINSIITSTNLATTAVTVSARRRKDAPEQLVSFFVPFEARTEYRTMEISPEVNRHLFASLSSRVPPYMVPSY
LIPVSQIPTTASGKVDWRRLRESFEDLTGHHAEAASSTTQCLDGASDWTVRESILADVIARTTKVPRDEIRRWTP
FAALGVDSITAIDLSRTLGSRLETWVSISSILQNPSVAQLAKSLEMKGRLGDETASQKSDALFTTLSGEVGTALG
RDPGDIEEILPCTPLQEAMLSQGTGSYYNKILLRLRIQADDLKAYWDEMSKRHGILRTCFVTTRRAEHPIAQVVL
RRWRVSWKTYDVHAPSLAGVSDEHLKCLPEPLNSGLPPLSCAFMRYKGSTFFSLICHHAIYDGVAMDNLWREIEA
LANQRSLPPPVPYKPFIQHVVDAPEDVDVFWAEHFRGFRPCRLFRRLAGAQVNQCTHTSSFGVTLMEVQERLRWL
GISLLSACQTAWATLLSAVSESPDIAFGTVVNGRIADMEGLDRLIAPCFNTIAMRVDLASISQNIELARQLQDVN
VQMIPYQFTPLRQIQKIVNCQRRALFDTLLLLQQPLKEMDDSVWTLEEDSGNMDVPLVCEMVPCPNLNSIVLNVH
YDIGIVSRDVTACLADIFIYLFRRLIDMPLASPDDKSTLPEALKLGLVDLVPRRDRPEGKSRRRYEDESWTDTEK
VIRGVFSELSGVPQTRIGRDTSIFQLGLDSINAVQVASMLRQKEYRVSASEVIECASCANLACRLLYAFEEKLPE
TTQAISLHKFADDVSSQVLNAMSSDNQFEAVLPATPMQSAMLASFLSSKGHKYLNMLAMEMDDNIGVESLHGAFA
VLQRQHPMLRTGFVSVRHKESSFAMVRHEEAFGGLPVESIHLERFQTFDLCEWQEVTRRDMLKLLHLPLWKAVLV
KQGDRLTLHLTMHHALYDAHSLDELLRSLSSLLLDGREPKFSRVEPALLEVLARGRQGQAAAQEFWEKHAGNAVV
NKFPLLTPLREETTGLSTRETSSSMSSSFLFNAAKDCGSSIQALVQAAWTRVLASYHGESSVVFGITMSGRITDH
GRAAPFPCIVTIPVVARNMESNRQLVEAMMEYNAEMHKHQFTPLSRIQKWLGHPATSVFDTLVVYQKRDGPKTAR
PPWRLVKDEAVVDYAVSLEVEPNAEDDDKLCLRLTFARNLIPEEQAHLIVQQFDATLHHLASEPTGNEDGLYRKR
PDLFAVTPASMPDMPAPVQFLHEFVEYSCRTWPETTALEFVDDWDRKSGTKRWSYRELDLMGNRVAHQLREHTLP
GDVVALHFQKCAEAYFSILGVLKAGCAFVALDPHAPKARKNFILNDSRARCLLAEDGVVIDVDVPIKVLGIAEET
LRKLSYERPSWVGSSLTPAHTCYCLYTSGTTGTPKGCEISHENAVQAMMAFQDLFQGHWDADSRWLQFAALHFDV
SMLEQYWSWAVGITVVSAPRDLILDDLAGAVRRLGITHVDLTPSLARLTSPEEMPSLRVFITGGEQLKQEILDKW
GPKAVIYNAYGPTEATIGVTMCPRVPVNGRPSNIGKQFLNVGSYVFRPLTETPVLRGAVGELCVSGKLVGKGYLR
RPELTKERFPTLVEFGERVYRTGDLVRILHDGCFEFLGRADDQIKLRGQRLEMGEINHAIRSGAAGVLDCATLLV
HRETPDKDVLVSFVVGRASTGRQRLSTLQDPDGLGAQARTACLGRLPAYMVPTYFLRLPYIPLSPNNKVEAKELK
SLFQSLSHEELMKLSAAAVALPTSLDEAGTGSIISIVSEFSGVAEDKFTPSTSLFDVGVDSITALQLTARLRERG
FRAASPAVLLKWPIIAHLVKALADNSSEVASIMVSGVREAKQLLQACHYRYLPFVCRELDVGPDEVEYIAPCSPL
QQGIIFKALSNESSDPYFSSFELRLDRGASVDRVRDAWSRTVDAHAILRSVFVNTPDGHIQVAMRQTKGQWQDVK
FESQDELFLTMETKRRDWVAKNRHHFGRPIELIHAQGPDSQRLFLHIFHALYDGSSLRLISHYAKALYRDEQPPS
SPPFIEALSHGPLSRHDQCRQFWTEHMRGWTPSPVPTLAASSDELRGVTVSRNVPLALLEGLRRQQNVTMQSVVL
ALWTSVLQRCLTSSVTVGVILSGRSIDLAGVERTIGPLFNTVPFFVDALRERTWSSLIREAHGFSTSVMPFQHVP
LKDIQSWCSGGRPLFDNLFVFQLEQPEWCDEAALWEVEDGPDRPDYPLALEATRTLGGNLRLCLVSQSRYADAVM
LEGMLDQFEQVMATAEAEATGSPWQGATEPNQGVLVGNSGEEEAEVMFDWTEEAVVVRNELALLARIPPEQVGAT
TMLLELGLDSIDAMKLSTRLKQRGINVSASNILRSQTIARLVGQLEMSGVALPSNSESSKLLEEIRSRLWIEVEN
GVTDAKMVESVLPPTPLQEAMVSGMVQSGFQWYFNHDILEVADWVDMERLGAAWRQLIEASPCLRSGFIEVGDSN
LDVSYCQVTFKSRTCCVKTRALADKSEMGQVMLDATRLAAQSKGLQDLVQIALVTVGERRLVVVSMAHALYDGWS
LGLMYRDLEELYWGRERKTQQTSTDAFVGRVLACRTEEARGFWTGHLAGLRPTLLTGRAKTTTKTGDWPLRKEAP
SGCSLSQLTSFCKRQAISLQVLCVATWAVVVAERTRGLDVVFGLVLSGRDGEGTEELMLPTMSTVALRCVLHGSV
SSFLKYVEETVTDVRGYQHYPLRRVQAAEAFNSLFLFQKTPRQNEASTRLFRSIDGQSAVEYPVCVEAEPVDDGL
VWRVACHRQLFSSQDTQLLLSRLDQVLQYMFDHEAIAVLSFEDEGVSICGLPVLEVEEGRVLDCRPDVTDDQPSE
QETWGDTATAIRHVLSQVSDMPVESITLRSSLYQLGLDSISAVKVSMLLRKRGIELKPRQLVKLSSLREMADNVT
LAGQDTKKQKSHPGVTWKPPRSMDVDELLRECNVPRDCVEAVLPATPMQAYMLTAWEKPGGAVFFPEFHYRMDGT
DDVLRAQEAWKMLSDQTAVLRTRFLATGFDEVPWIQAVMHKEAIRSGRISQPLVRLDINKADSGKGLELRLKIHH
ALYDELSLAALTSQLCELVNSTAAPESDDDDDDDDDDDDGFSRWALYCNALPDGRARRREFWTEYLRGGTAVDIE
ASSATDTAERASYLDKSAVNDVTDLRATASQHSISLQALVLAALAKSLAGRDSERAIILGIYLANRAGGERDSPP
ATCPTLNLVPVKVQPSPGLRLVDMARAIQADVVSIGDDGRAQVGLWEILAWTGVRIGCFVNFLVGGAKVDRVGDV
VTLRSVQGDVMPIMVMGEASPRGPRRNVVSDAVEPSVDIEASVSGDKALAVGVFGPRGRVTDEWAAKLVADTVAF
LAEAGAGG
Coding >Ophio5|1454
ATGGCCGCCCAAGGCTTGTCCATCATCAATCCGCGTCCAACCAGGTTGTTGGGTCCAAGCTTGCTTCATCAGCTA
ATCGCTCCGCCTTCCGAACACTTAGCTCTTGATCAGCTGGGCCAGGACGGGAAATGTTCATACACGTATCGAGGC
TTGCACAACGCCGCTGCAGCCATCGCCAGTCTCCTCGTTGACGTCCGTTCATCGGTTGCACGGAGCCGCACTCCA
TTCGTCGTCCCTGTACTCATCCCGCAGTCGTCCTTACTTTGCATCTCTCTGCTCGCCGTTCTCAAAGCTGGCGGT
GCCTTTTGTCCTCTCAACCTCGATGCCCCTCGTGAGAGAATCAAGTTTATTCTTAACGATGTCTCCGCCACTGTC
GTCCTCGTCTCACGCTCCACGGCGCATTTGGTGCCCGCGGAAAACCATGTACAAGTTATAATGGTGGATGACATC
GACAATGGGAAAACTTCCATGCCAACTCCTGATCATCAGGAGCCTACTCCAGAGGACGTGGCCTATGTCATGTAC
ACGTCTGGATCGACCGGGACGCCCAAAGGCGTATGTATCCCTCATGATGCCGTAACGCAAGCCCTCCTTGCCCAC
GACCGTCACATACCGGCCTTTTCCAGGTTTCTGCAATTCGCCGCACCTACGTTCGACGTCTCAGTCTTCGAAGTC
TTCTTCCCCCTTTTTCGCGGTAGCACCCTGGTCACTGCCCGCCGCGATGAGCTGCTGGATGACCTGCCATCGGTT
CTTCGGAAGATGAACGTCGATGCCTGCGAGTTGACGCCCACAGTCGCTGCGAGCCTGCTCAGAAGACGCCAGAAT
GCGCCCGCTCTCAAGCTTCTCCTGACCATAGGCGAGATGCTGACCCTCCCCGTCGTCGAGGAGTTTGGCGGGTCT
GAAACAAGGCCCAGCATCCTCTGGGCCATGTATGGGCCAACAGAAGCAACCATTCATTGCACGCTGCAGGCCGCC
TTGACGTCTGAGTCATCAACAGGGAACATTGGAAGCCCCCTTGATACAGTTTCCTGCTTCGTCGTTGAGCCTCGG
GCCTCTGGCCATGACCAAAGCGCCTTCAAAGTTCTCCCGCAGGGCGAAGTCGGTGAATTGGCCGTCGGCGGCTAC
CAGTTGGCCCGCGGTTATCTAAACCGCCCAGAACAAACAGCTTCTGCTTTCATCACCACTCCTTACGGTCAGGTT
TACCTTACGGGAGACAAGGCTCGCGTGACGCCTGATGGAAAGCTCGAATGTCTCGGTCGCTTGACGAGCGGGCAG
GTGAAGCTGCGTGGCCAGCGCATCGAGACTGGTGAGGTGGAACAGTCGGCTCTGAAGACACCAGGCTGCCATGGC
GCTGTAGCAGCCGTCGTTGACGCCAGTTTGGTCCTATTCTGCGCCGTCGATCCAGGCACTTCTGAGGATGCCATT
GCCACGAGCTGCAGCAACTGGTTGCCCGGCTTCATGGTCCCAGGGGAGATTGTCTTGATGGTTGAGTTTCCTCGC
TTGCCAAGTGGAAAGATCGATGCACAGAAGCTCAAGTCAATCTATCAGGAGCAGAAGTTGGCCGAATTTTCTGAG
CACGACGAGATGGTGCTCGCTGAGGAGGAAGTGATTCTTCATGTGATCTCGTCTGTTTTGGAACGACAAGTAAGC
AAGCAGATGACACTGGCCTTTGCCGGCGTAGATTCACTTTCAGCAATCAAGCTGGCGTCTGCGCTGCGACTGTCA
GGCTTCGGGATGAGTGCCTCTGATATGCTGAAACTGAAGACAGTAGCAGACCTTTGCTGTCATATTCGCAAACGA
CCCATGATGAAGCTGTCGAACCATGAAGTTTTCAGTGTAAGCATACTGGCCGACTGGGGCCATATCCTTGCTCAG
AACCCCGGATTGGACCTGGCAAAAAGAAACATGGATGACGTTATCCCCTGCACTTCGCTTCAAACGGCTTTGTTG
GCTGAGACGGCGCGCGATCCCCAGCTCTATTGCAACCAGCTCGAGTTTCAGGTCGCACCAGGATATACAGTCAGC
GACGTTGCGGATGCAATCTGCCAAGTTGCGGCGGAAAACGAAGTCCTCCGCTCAGGCTTCGTTTCGTTGCGTGGT
GGATATGCTGTCGTCTTGTTCAGGGACTTTGGGACCGACGATAACCTCCGCGTCGTGCCACAGTTTGACGAGAGC
TTTTCGTTTCTGCATCCGCACGACTTCCTTAAGCCATTCCGAGTTCAGATCTGCAACAAGGAGAAGGATGCTGGA
CTTCGAGTTCTTTTCCAGGTTCATCACGCCGTCTACGACGGTTGGTCCATGGATCTGATCTTGTCCGACTTGTCC
GCGCTGCTGCGACGTGTTCCGCTCTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGACATCACCTGAGAGACTTC
AAGGACGTCGAAGATGACTCGGCGATGAAGTTTTGGGGCGAGCACCTGACGGGATGGAACAAGTCCTCTTTCCCG
AAGCTGGCGGCTCAATCCCCTATGTCGAATGAGGTTCAGACAAGGAGCCACACGTTGGAGATACTGCCCGAGCAG
GTAAAGCGAATGGCAGGAGAGTGGGCGGTAGGTGTCCAGGTGCTGTTCCAAGCATCTTTGGCTCTGCTATGGAGT
GGCATCGCTGGAGAGCAAGATATGGTGCTTGGGTCCGTGACTTCTGGGCGGACAATAGCCGTGGATCAAATCGAG
GAGATAGTCGGGCCTTGCATTGCGTCTCTGCCTTTCCGAGTCGATCTCAACAACATGATTTCTGTCAAGGACTTA
CTGCCGTCTGAGAGTCTATACGACATTCTCATCGTCTATCAGGAGTCTCTCGAGAGCTTGAAAAAACAAGACTGG
CTCCTTACCGAACCTCGCGAATCATGTTACAGGATCCAGGCCACCTACCACTCTTCGTTCTTTGCGCCTGGTCTA
GTCGACTGCCTCCTCCAACAGTTCGATGACATGACGGGGATGCTGCTGAAGAGTCCCGATATGTGTCTTCGATCT
GTTCGGTCTGCCATGCCCGGGCTGTCGCTCCATAACGAAGCCGTGCAGCCGTTTCTCGGAGTGCCTGACCTTGCT
GCTCAGTTTGAGGCGACGGCGGCCGCCATGCCTACGGCCGCTGCGTTGTGCTTCTGCGACTCGTTCACCTCTCTG
GGTCCCCGGACGCTGTCGACCTCCTATGAAGAGCTGAATAGAGCTGCTAATCAAGTCGCCCATTATCTGTGCAGT
CAGCTGATCCCGATCGGAGAGGTTCTGGCTGTGCTCATGTCAAAATCTCCCACGTTTTACACCACTGTCCTTGGT
GTTCAAAAGGCAGGATGCGCGTACCTGCCCATTCTTCCCCAGACGCCCGAGGTGCGGGTGCGCACCATTCTCAAG
CAGGCTGGAGTCAAGCACTGCCTCGTTGATAATGCCTCTTTACCGATGTTCTCGCTTGAAGGCGTGCGGATTCAC
GACGTGGAGCGCGTCGAGATGCAGCGTTACTCGCCAGATAATCGGAACATCCCACGCACTGCTTCTCGTCTGGCC
TATGTCATCTACACTTCAGGAACTACAGGGGTGCCGAAAGGCGTTGCTGTCACGCAGGAAAACATCGTCAGCAAC
ATCACAGTCTTGCGATCCATCTACCCCAAGCCCAAGACGGCAGAGCCGCGACTGCTCCAGGCCTGCTCCCAAGCG
TTTGACGTGTCTGTTTTTGAGATATTTTTCGCCTGGCACGCGGGCATGTGCCTGTGTGCAGCCCCGAACGACATC
TTATTCCAAGACCTGGAGCGCTTCATGCGCCTGTTGAAGATTAGCCACTTGAGCTTGACGCCGACGTTGGCCTCG
CTCATAGATGCCGCCAAGGTACCAGGTGTCGAGTTTCTCGTCACTGCCGGCGAGCCGATGACGCTGTCCGTTTTG
GATCGATGGCACGACCGGCTTTGGCAAGGATATGGGCCGTCCGAAACGACCAACATATGCAGCGTGAAGCACATG
GCACGCGGAGAAAACATTGAGCATCTTGGCTGGGCTCTGCCCAACACGTCGACGTTTGTCATGCGGACCATGGCC
GCGGAGACTGTCCCCGTCGGATGGGTGGGCGAACTCTGCTTTGGCGGCCATCAGGTCGCGTGGGGATACTTGAAC
GACACTCGTCTGACGAAGGAGAAGTTTGTCCATCACCCCAAATATGGAAGGATTTACCGTTCTGGAGATCTGGGT
CGAATGCTCCCTGATGGCTCGCTGGTGATCCTTGGCCGGCTCGACGATCAGATTAAGCTGCGAGGCCAGCGGATC
GCAGCCGGCGAAATCAACAGTATCATCACTTCCACCAATCTGGCAACCACTGCCGTGACGGTCTCTGCTCGACGG
CGGAAAGACGCACCAGAGCAGCTGGTGTCGTTCTTCGTCCCCTTTGAAGCCCGAACTGAATACCGGACGATGGAG
ATCTCGCCGGAAGTCAACCGCCATCTCTTCGCAAGCTTGTCATCTCGGGTGCCGCCGTACATGGTGCCATCCTAC
TTGATTCCCGTATCTCAAATACCCACGACGGCTAGTGGCAAGGTAGACTGGCGACGCCTTCGAGAGAGTTTTGAG
GACTTGACCGGGCATCACGCCGAGGCTGCCTCTTCCACCACGCAATGTCTCGATGGCGCGAGCGACTGGACTGTA
AGGGAATCGATTCTTGCCGACGTCATCGCGCGTACGACAAAGGTCCCGCGAGATGAGATAAGACGGTGGACGCCG
TTCGCGGCCCTGGGCGTAGATTCCATTACTGCCATTGACTTGTCTCGCACGCTGGGCTCTCGCCTGGAGACCTGG
GTGTCGATATCCTCCATTCTTCAGAACCCGTCCGTTGCTCAGCTGGCCAAGTCGCTGGAGATGAAGGGAAGGCTC
GGTGACGAAACCGCCTCTCAAAAGTCTGACGCTCTGTTTACAACCTTGTCCGGCGAGGTTGGTACCGCCTTGGGC
CGAGACCCGGGAGATATCGAAGAGATCCTTCCGTGCACGCCACTGCAGGAAGCCATGCTTTCGCAAGGGACGGGA
AGCTATTATAACAAGATCCTGCTGCGACTCCGCATCCAGGCCGATGACCTGAAGGCCTACTGGGATGAGATGTCC
AAACGACACGGAATTCTCAGAACCTGTTTCGTCACGACGCGGCGCGCCGAGCATCCGATTGCGCAAGTAGTCCTG
AGGCGATGGAGGGTGTCGTGGAAGACGTATGACGTTCACGCGCCCTCCCTTGCTGGCGTATCCGACGAGCATCTG
AAGTGCCTTCCGGAGCCCCTGAACTCGGGCCTGCCCCCTCTGTCTTGCGCCTTTATGAGATATAAAGGTTCAACT
TTCTTTTCGCTGATCTGCCATCATGCCATTTATGACGGCGTCGCCATGGACAACCTGTGGCGGGAAATCGAAGCC
TTGGCCAACCAGCGCAGCCTTCCCCCCCCTGTGCCCTACAAGCCGTTCATACAGCACGTTGTCGACGCTCCCGAG
GATGTTGATGTGTTCTGGGCCGAGCATTTCCGCGGCTTCCGGCCTTGCAGGCTCTTCAGACGCTTGGCCGGTGCG
CAGGTGAACCAATGTACTCATACCAGCTCTTTTGGCGTGACGTTGATGGAGGTCCAAGAACGCTTAAGATGGCTC
GGAATCTCTCTTCTCTCTGCATGCCAGACGGCGTGGGCAACACTTCTCTCGGCAGTAAGCGAGAGTCCAGATATT
GCCTTTGGTACCGTCGTCAACGGCCGTATCGCCGACATGGAAGGTCTGGACCGGTTGATTGCCCCCTGCTTCAAC
ACTATTGCGATGCGTGTCGACCTTGCAAGCATTTCCCAGAACATCGAATTAGCCAGACAGTTGCAAGATGTCAAC
GTACAGATGATCCCGTATCAGTTCACGCCATTGCGACAGATTCAGAAGATCGTCAACTGTCAACGTCGGGCATTG
TTTGATACCTTGCTGCTCCTTCAGCAACCACTCAAGGAGATGGACGACAGCGTTTGGACACTCGAAGAGGATTCA
GGAAACATGGACGTCCCGCTGGTGTGCGAGATGGTTCCATGTCCAAACCTCAACTCGATCGTCCTCAACGTCCAT
TATGACATCGGAATCGTCTCCAGGGACGTTACTGCATGTCTGGCCGACATCTTCATATACCTTTTCCGTCGTCTG
ATTGACATGCCGCTCGCGAGCCCAGATGATAAGAGCACCTTACCAGAGGCTCTGAAGTTGGGTCTCGTGGATCTC
GTCCCAAGGCGTGACAGGCCAGAGGGTAAAAGCCGCCGGCGATATGAGGACGAGAGCTGGACCGACACCGAGAAG
GTGATTCGGGGAGTCTTCTCGGAGCTTTCTGGTGTGCCGCAGACAAGGATCGGCCGTGATACCAGCATATTCCAG
CTCGGATTGGACAGCATCAACGCTGTTCAGGTCGCTTCGATGCTCCGGCAGAAGGAATATAGGGTTTCTGCGTCG
GAAGTCATCGAGTGCGCCAGCTGTGCGAATTTGGCCTGTCGACTGCTCTACGCCTTCGAAGAGAAGCTGCCGGAG
ACAACGCAGGCGATCAGCCTGCACAAATTCGCCGACGACGTCTCCTCACAAGTACTTAACGCGATGTCGTCTGAT
AACCAATTTGAGGCCGTTCTCCCTGCCACGCCCATGCAGTCGGCCATGCTGGCCTCATTTCTCTCCTCAAAGGGC
CACAAATACCTCAACATGCTGGCAATGGAGATGGACGACAACATTGGCGTGGAAAGCCTGCATGGGGCTTTCGCA
GTCCTCCAGCGGCAGCATCCGATGCTCCGTACTGGCTTCGTTTCTGTGAGACATAAAGAGAGCTCGTTTGCCATG
GTACGACATGAGGAGGCTTTCGGCGGCTTGCCTGTTGAGAGCATCCATCTCGAGCGGTTTCAGACGTTCGACTTG
TGTGAATGGCAAGAGGTCACTCGGCGAGACATGCTGAAGCTTCTACATCTGCCACTTTGGAAAGCGGTCTTGGTC
AAGCAAGGGGATCGGCTGACGCTTCATCTCACCATGCATCATGCTCTCTATGACGCACACTCGCTAGATGAGCTC
CTACGAAGCCTCTCAAGCCTCCTACTCGATGGCAGAGAGCCTAAATTCTCCAGGGTCGAACCAGCTTTGTTGGAG
GTTCTTGCCCGCGGTCGACAAGGGCAGGCGGCTGCTCAAGAGTTCTGGGAGAAGCATGCGGGCAACGCCGTGGTG
AACAAGTTTCCACTTTTGACGCCTTTGAGAGAAGAGACAACGGGTCTGTCAACCCGCGAAACGTCTTCGTCAATG
TCCTCCAGCTTTCTCTTTAACGCCGCCAAGGACTGCGGTAGCTCAATCCAGGCGTTGGTGCAAGCCGCCTGGACA
CGCGTTCTGGCCTCGTATCATGGCGAGAGCTCGGTTGTATTTGGGATCACAATGTCAGGGCGTATCACCGACCAC
GGTCGAGCCGCTCCGTTTCCCTGCATCGTCACCATCCCAGTTGTGGCGCGTAACATGGAGTCAAACAGACAGCTT
GTCGAAGCAATGATGGAGTATAATGCCGAAATGCACAAGCATCAGTTCACCCCGTTGAGTCGGATCCAGAAATGG
TTAGGTCATCCTGCCACTTCCGTCTTCGACACGCTTGTTGTCTATCAAAAGAGAGACGGACCGAAGACGGCACGC
CCGCCTTGGAGGTTGGTCAAGGATGAAGCGGTTGTTGACTACGCCGTCTCTCTCGAGGTCGAGCCGAATGCTGAG
GATGATGATAAACTATGCCTCCGGCTCACCTTTGCCAGAAACCTCATACCGGAGGAACAGGCGCACCTCATCGTT
CAACAGTTCGACGCCACACTGCATCATCTGGCCAGCGAGCCTACCGGGAACGAAGATGGACTCTACAGAAAGCGA
CCTGATCTTTTCGCAGTCACCCCGGCTTCGATGCCAGACATGCCTGCTCCGGTACAATTTCTTCATGAGTTCGTG
GAGTATAGCTGCAGGACTTGGCCAGAAACAACGGCCTTGGAGTTTGTGGACGACTGGGACAGAAAGTCGGGCACG
AAAAGATGGAGCTACAGAGAACTCGATCTGATGGGAAACCGCGTCGCTCATCAGCTGCGAGAGCATACCCTTCCC
GGAGACGTGGTGGCACTTCACTTTCAGAAATGCGCCGAGGCGTATTTTTCGATCCTCGGTGTCCTCAAAGCCGGC
TGTGCATTCGTCGCCCTCGACCCTCATGCTCCGAAGGCAAGGAAGAACTTCATCTTGAATGATTCACGTGCGAGG
TGCCTTTTAGCGGAGGACGGAGTGGTGATAGATGTCGACGTTCCCATCAAAGTGCTGGGAATCGCCGAGGAAACG
CTTCGAAAGCTGTCGTACGAGCGTCCGTCTTGGGTCGGGAGCAGTCTGACGCCTGCCCACACCTGCTATTGTCTT
TACACGTCCGGCACGACGGGGACGCCCAAAGGATGCGAGATCAGTCACGAGAATGCGGTCCAGGCCATGATGGCC
TTTCAAGACCTGTTCCAAGGGCACTGGGACGCCGACTCGCGCTGGCTGCAGTTTGCGGCGCTTCACTTTGACGTC
TCCATGCTCGAGCAGTACTGGAGTTGGGCAGTGGGCATCACGGTCGTGTCCGCGCCCCGAGATCTGATCCTGGAC
GACCTCGCCGGGGCAGTTAGGAGGCTCGGCATCACCCATGTCGACCTCACCCCTAGTCTGGCCCGGCTGACGAGT
CCTGAGGAGATGCCGAGTCTGCGCGTCTTCATCACGGGAGGAGAGCAACTGAAGCAGGAGATTCTCGATAAATGG
GGCCCAAAGGCCGTCATCTACAACGCCTACGGCCCTACGGAGGCGACCATCGGCGTGACCATGTGTCCGCGCGTG
CCCGTCAACGGACGCCCGAGCAACATTGGTAAACAGTTTCTCAATGTCGGCTCTTACGTCTTTCGTCCATTGACC
GAGACTCCTGTCCTACGAGGTGCCGTCGGGGAGCTGTGCGTGTCAGGCAAGCTGGTGGGCAAGGGATACCTGCGC
CGTCCAGAGCTCACCAAGGAGCGGTTCCCGACGCTCGTCGAGTTTGGTGAAAGGGTCTACAGGACGGGCGACCTG
GTGCGGATCCTCCACGACGGATGCTTTGAGTTTCTTGGCCGCGCAGACGATCAGATCAAGTTGCGCGGACAGCGG
CTGGAGATGGGCGAGATTAACCACGCAATCCGCTCAGGGGCGGCGGGCGTTCTCGATTGTGCAACGCTCTTGGTG
CACAGAGAGACTCCGGACAAGGATGTCTTGGTGTCCTTTGTTGTCGGACGGGCGTCAACCGGCCGTCAAAGGCTC
TCCACGTTGCAAGACCCCGACGGACTTGGTGCTCAAGCAAGAACGGCTTGTCTTGGGAGGCTGCCGGCCTACATG
GTGCCAACATATTTCCTCCGGCTGCCGTACATACCTCTCTCGCCGAACAACAAGGTCGAAGCTAAAGAGCTCAAG
TCGTTGTTTCAGTCTCTCTCGCATGAGGAGCTGATGAAGCTGTCGGCCGCTGCTGTGGCTCTCCCGACGAGCCTC
GACGAGGCCGGCACTGGCAGCATCATCAGCATCGTGTCCGAGTTTAGCGGCGTCGCAGAAGACAAGTTCACGCCG
TCGACCAGCCTGTTCGACGTCGGCGTGGACTCCATCACCGCCCTGCAATTGACCGCCCGGCTTCGCGAACGAGGT
TTCCGGGCTGCCTCTCCCGCTGTGTTGCTGAAATGGCCCATCATCGCGCACCTCGTCAAAGCCCTGGCCGACAAC
TCCTCAGAAGTAGCAAGCATCATGGTTAGCGGTGTGAGGGAAGCTAAACAGCTCCTGCAGGCCTGTCACTACAGA
TATCTCCCATTCGTGTGCCGCGAGCTGGACGTGGGGCCTGATGAGGTTGAATATATTGCGCCGTGCTCGCCGCTG
CAACAGGGCATCATCTTCAAAGCTCTCAGTAACGAGAGCTCCGACCCTTACTTTTCCTCTTTCGAGCTGAGACTG
GATAGAGGCGCCTCGGTTGACAGAGTCCGCGACGCCTGGAGTCGGACTGTTGATGCTCACGCCATACTTCGATCT
GTTTTTGTCAACACCCCTGATGGGCATATTCAGGTCGCAATGCGTCAGACAAAGGGTCAATGGCAAGACGTGAAA
TTTGAATCTCAAGACGAACTCTTTCTCACCATGGAAACGAAAAGGCGAGATTGGGTTGCGAAAAACAGGCATCAC
TTTGGCCGCCCCATCGAGCTCATTCACGCGCAGGGGCCGGACTCTCAGAGGCTCTTCCTCCACATCTTCCATGCG
CTCTACGACGGCAGCAGCTTGCGACTCATCAGCCACTATGCCAAGGCCCTGTACCGCGACGAGCAACCGCCGTCA
AGCCCCCCATTTATCGAGGCCTTGAGCCACGGGCCGCTCTCAAGACACGATCAGTGCCGACAGTTTTGGACGGAG
CACATGCGTGGCTGGACACCGTCACCAGTGCCGACGCTCGCAGCATCGTCAGACGAACTCAGAGGCGTGACAGTC
AGTCGCAACGTTCCGCTGGCCCTACTCGAGGGGCTGCGACGTCAACAAAACGTCACGATGCAGTCTGTCGTGCTC
GCCCTGTGGACTTCGGTCCTCCAGAGATGTCTGACCAGCAGCGTCACAGTTGGCGTCATTCTTTCAGGCAGGTCT
ATTGACCTTGCTGGGGTCGAGCGGACAATCGGCCCTCTGTTCAACACCGTGCCCTTCTTCGTCGACGCCCTGCGA
GAGCGCACTTGGTCGTCGTTGATCCGCGAGGCCCATGGCTTCAGCACTTCGGTAATGCCTTTCCAACATGTGCCC
CTGAAGGACATCCAGTCATGGTGCTCTGGAGGCCGTCCGCTTTTCGACAATCTCTTTGTGTTCCAGCTTGAACAG
CCTGAATGGTGCGACGAAGCTGCGCTTTGGGAGGTCGAAGACGGTCCGGATCGCCCCGATTACCCCCTGGCGCTC
GAAGCGACGCGAACATTAGGGGGGAACTTACGGCTATGCCTTGTGTCGCAAAGCCGGTATGCTGATGCAGTCATG
CTGGAGGGCATGCTGGACCAATTCGAACAGGTGATGGCGACAGCCGAGGCGGAGGCAACGGGGAGTCCTTGGCAA
GGCGCTACAGAGCCCAATCAGGGGGTGTTAGTCGGGAACTCTGGAGAGGAAGAGGCGGAGGTCATGTTCGACTGG
ACGGAGGAAGCTGTTGTGGTGAGGAATGAGTTGGCGCTACTTGCCCGCATACCCCCTGAACAAGTCGGCGCAACA
ACTATGCTGCTGGAGCTGGGCCTTGACAGCATTGATGCGATGAAGCTCTCAACAAGGCTGAAGCAGCGTGGAATC
AACGTATCTGCGTCAAACATACTGCGAAGCCAGACGATAGCCCGTCTCGTTGGTCAGCTGGAGATGAGCGGCGTT
GCGCTTCCATCCAACTCTGAGTCTTCGAAACTCCTCGAAGAGATAAGATCTAGGCTCTGGATCGAGGTAGAGAAT
GGTGTGACAGACGCGAAAATGGTTGAGTCGGTCTTGCCTCCGACTCCTCTCCAGGAAGCCATGGTTTCGGGCATG
GTTCAGTCAGGCTTTCAGTGGTACTTCAACCACGATATCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTT
GGTGCCGCGTGGAGGCAGCTGATCGAGGCATCGCCATGCTTGAGAAGCGGCTTCATCGAAGTTGGCGACTCGAAT
CTGGACGTGTCGTACTGCCAAGTCACCTTCAAGAGCAGAACTTGTTGCGTCAAGACGCGGGCGCTGGCGGACAAG
TCTGAGATGGGACAGGTGATGCTGGACGCGACGCGGCTGGCTGCTCAAAGCAAGGGACTGCAAGACTTGGTGCAG
ATTGCGCTGGTGACGGTTGGCGAGCGACGTCTCGTTGTCGTTTCCATGGCTCATGCTCTCTACGACGGTTGGTCG
CTCGGGCTCATGTATCGGGATCTGGAAGAGCTGTACTGGGGGCGGGAGAGGAAGACACAACAAACATCCACCGAT
GCTTTTGTTGGGCGCGTTCTGGCCTGCAGGACGGAAGAGGCCCGCGGTTTCTGGACTGGTCATCTCGCGGGCCTT
CGGCCGACTTTGTTGACAGGAAGGGCGAAGACGACAACGAAAACAGGAGACTGGCCGTTGCGCAAAGAAGCTCCG
TCCGGCTGCAGTCTCTCTCAACTAACAAGCTTCTGCAAGAGGCAGGCAATCAGTCTACAGGTGCTCTGCGTCGCC
ACATGGGCTGTCGTCGTGGCGGAGCGAACCAGGGGCCTCGATGTCGTCTTCGGACTCGTGCTGTCTGGCAGAGAC
GGAGAGGGGACGGAGGAGCTGATGTTGCCGACCATGAGCACAGTGGCCTTGCGCTGCGTCCTTCACGGCTCCGTC
TCCAGCTTCCTCAAATATGTGGAGGAGACGGTGACGGATGTCAGGGGCTATCAGCATTACCCCCTGCGCAGGGTT
CAAGCTGCGGAGGCCTTTAACTCGCTTTTCCTATTCCAAAAGACGCCCAGACAGAATGAGGCGTCGACCCGGCTG
TTTCGGTCCATCGACGGCCAGTCAGCTGTCGAATATCCGGTCTGTGTCGAGGCCGAGCCCGTCGACGATGGACTT
GTTTGGCGTGTCGCCTGCCACCGACAACTCTTCTCCAGCCAAGACACCCAGCTGCTACTCAGTAGGTTGGATCAG
GTGCTACAGTACATGTTTGACCACGAGGCCATTGCTGTCCTCTCCTTCGAGGATGAGGGCGTGTCGATTTGCGGG
CTGCCGGTGCTGGAGGTCGAGGAAGGGCGTGTCCTCGACTGCCGGCCCGACGTGACCGACGACCAGCCAAGCGAG
CAGGAAACCTGGGGAGACACGGCTACTGCAATTCGCCATGTCTTGAGCCAGGTTTCGGACATGCCAGTCGAGTCG
ATAACGCTTCGATCCAGCCTGTACCAGCTCGGCCTCGACTCCATCAGTGCCGTCAAGGTGTCGATGCTACTCCGC
AAGAGAGGAATCGAACTAAAACCGAGGCAGCTCGTCAAGCTGTCGAGCTTGAGGGAAATGGCAGACAACGTGACG
CTCGCAGGACAAGACACTAAGAAGCAGAAGTCCCATCCGGGAGTGACGTGGAAGCCCCCTAGGTCCATGGACGTG
GACGAGCTGCTCCGAGAGTGTAACGTGCCGAGAGACTGCGTCGAGGCGGTGCTGCCAGCGACGCCGATGCAGGCG
TACATGCTGACGGCATGGGAGAAGCCAGGCGGCGCCGTCTTCTTCCCAGAGTTTCACTACCGTATGGACGGCACT
GATGACGTGTTGAGGGCCCAAGAGGCATGGAAGATGCTCAGCGACCAGACGGCCGTGCTGCGAACACGCTTCTTG
GCCACCGGCTTTGATGAGGTACCGTGGATCCAGGCGGTGATGCACAAGGAGGCCATCCGATCCGGCCGCATATCA
CAGCCCCTGGTCCGTCTCGACATCAACAAGGCCGACTCGGGCAAGGGACTGGAGCTGCGACTCAAGATACACCAT
GCCCTGTATGATGAACTCAGCCTGGCAGCCCTGACTTCGCAGCTGTGCGAGCTTGTGAACAGCACGGCAGCCCCT
GAGAGCGACGACGACGACGACGACGACGACGACGACGACGACGGTTTCTCACGGTGGGCGCTCTACTGCAATGCT
CTGCCGGACGGCCGGGCCAGACGGCGAGAGTTCTGGACCGAGTATTTGAGGGGAGGCACCGCCGTCGACATTGAA
GCGTCTTCGGCGACCGACACGGCCGAGAGAGCGTCCTACCTCGACAAGTCAGCCGTGAACGACGTGACGGATCTA
CGGGCAACGGCCTCACAGCACAGCATAAGCCTGCAAGCACTCGTCTTAGCCGCGCTGGCGAAGAGCCTGGCCGGA
CGAGACTCGGAGCGTGCAATCATCCTGGGCATCTACCTCGCCAACCGAGCCGGCGGCGAACGAGACTCGCCACCT
GCGACGTGTCCGACGCTCAACCTAGTGCCGGTCAAGGTGCAGCCAAGTCCGGGCCTCCGTCTTGTCGACATGGCG
AGGGCGATTCAAGCCGATGTCGTCAGCATAGGCGACGACGGACGAGCCCAAGTCGGGCTCTGGGAGATTCTGGCC
TGGACGGGCGTCCGGATCGGCTGCTTCGTCAACTTTCTCGTCGGCGGCGCCAAGGTGGACCGCGTCGGGGATGTC
GTCACTCTCCGTTCCGTACAAGGAGACGTCATGCCCATCATGGTGATGGGAGAAGCGTCGCCGCGCGGGCCCAGG
AGGAACGTGGTTAGCGACGCGGTCGAGCCTTCGGTCGACATCGAGGCCTCGGTCAGCGGGGACAAGGCTCTCGCC
GTCGGAGTCTTTGGCCCGAGGGGGCGCGTGACGGACGAGTGGGCCGCCAAGCTGGTTGCCGATACGGTTGCGTTC
CTGGCCGAGGCGGGCGCGGGCGGT
Transcript >Ophio5|1454
ATGGCCGCCCAAGGCTTGTCCATCATCAATCCGCGTCCAACCAGGTTGTTGGGTCCAAGCTTGCTTCATCAGCTA
ATCGCTCCGCCTTCCGAACACTTAGCTCTTGATCAGCTGGGCCAGGACGGGAAATGTTCATACACGTATCGAGGC
TTGCACAACGCCGCTGCAGCCATCGCCAGTCTCCTCGTTGACGTCCGTTCATCGGTTGCACGGAGCCGCACTCCA
TTCGTCGTCCCTGTACTCATCCCGCAGTCGTCCTTACTTTGCATCTCTCTGCTCGCCGTTCTCAAAGCTGGCGGT
GCCTTTTGTCCTCTCAACCTCGATGCCCCTCGTGAGAGAATCAAGTTTATTCTTAACGATGTCTCCGCCACTGTC
GTCCTCGTCTCACGCTCCACGGCGCATTTGGTGCCCGCGGAAAACCATGTACAAGTTATAATGGTGGATGACATC
GACAATGGGAAAACTTCCATGCCAACTCCTGATCATCAGGAGCCTACTCCAGAGGACGTGGCCTATGTCATGTAC
ACGTCTGGATCGACCGGGACGCCCAAAGGCGTATGTATCCCTCATGATGCCGTAACGCAAGCCCTCCTTGCCCAC
GACCGTCACATACCGGCCTTTTCCAGGTTTCTGCAATTCGCCGCACCTACGTTCGACGTCTCAGTCTTCGAAGTC
TTCTTCCCCCTTTTTCGCGGTAGCACCCTGGTCACTGCCCGCCGCGATGAGCTGCTGGATGACCTGCCATCGGTT
CTTCGGAAGATGAACGTCGATGCCTGCGAGTTGACGCCCACAGTCGCTGCGAGCCTGCTCAGAAGACGCCAGAAT
GCGCCCGCTCTCAAGCTTCTCCTGACCATAGGCGAGATGCTGACCCTCCCCGTCGTCGAGGAGTTTGGCGGGTCT
GAAACAAGGCCCAGCATCCTCTGGGCCATGTATGGGCCAACAGAAGCAACCATTCATTGCACGCTGCAGGCCGCC
TTGACGTCTGAGTCATCAACAGGGAACATTGGAAGCCCCCTTGATACAGTTTCCTGCTTCGTCGTTGAGCCTCGG
GCCTCTGGCCATGACCAAAGCGCCTTCAAAGTTCTCCCGCAGGGCGAAGTCGGTGAATTGGCCGTCGGCGGCTAC
CAGTTGGCCCGCGGTTATCTAAACCGCCCAGAACAAACAGCTTCTGCTTTCATCACCACTCCTTACGGTCAGGTT
TACCTTACGGGAGACAAGGCTCGCGTGACGCCTGATGGAAAGCTCGAATGTCTCGGTCGCTTGACGAGCGGGCAG
GTGAAGCTGCGTGGCCAGCGCATCGAGACTGGTGAGGTGGAACAGTCGGCTCTGAAGACACCAGGCTGCCATGGC
GCTGTAGCAGCCGTCGTTGACGCCAGTTTGGTCCTATTCTGCGCCGTCGATCCAGGCACTTCTGAGGATGCCATT
GCCACGAGCTGCAGCAACTGGTTGCCCGGCTTCATGGTCCCAGGGGAGATTGTCTTGATGGTTGAGTTTCCTCGC
TTGCCAAGTGGAAAGATCGATGCACAGAAGCTCAAGTCAATCTATCAGGAGCAGAAGTTGGCCGAATTTTCTGAG
CACGACGAGATGGTGCTCGCTGAGGAGGAAGTGATTCTTCATGTGATCTCGTCTGTTTTGGAACGACAAGTAAGC
AAGCAGATGACACTGGCCTTTGCCGGCGTAGATTCACTTTCAGCAATCAAGCTGGCGTCTGCGCTGCGACTGTCA
GGCTTCGGGATGAGTGCCTCTGATATGCTGAAACTGAAGACAGTAGCAGACCTTTGCTGTCATATTCGCAAACGA
CCCATGATGAAGCTGTCGAACCATGAAGTTTTCAGTGTAAGCATACTGGCCGACTGGGGCCATATCCTTGCTCAG
AACCCCGGATTGGACCTGGCAAAAAGAAACATGGATGACGTTATCCCCTGCACTTCGCTTCAAACGGCTTTGTTG
GCTGAGACGGCGCGCGATCCCCAGCTCTATTGCAACCAGCTCGAGTTTCAGGTCGCACCAGGATATACAGTCAGC
GACGTTGCGGATGCAATCTGCCAAGTTGCGGCGGAAAACGAAGTCCTCCGCTCAGGCTTCGTTTCGTTGCGTGGT
GGATATGCTGTCGTCTTGTTCAGGGACTTTGGGACCGACGATAACCTCCGCGTCGTGCCACAGTTTGACGAGAGC
TTTTCGTTTCTGCATCCGCACGACTTCCTTAAGCCATTCCGAGTTCAGATCTGCAACAAGGAGAAGGATGCTGGA
CTTCGAGTTCTTTTCCAGGTTCATCACGCCGTCTACGACGGTTGGTCCATGGATCTGATCTTGTCCGACTTGTCC
GCGCTGCTGCGACGTGTTCCGCTCTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGACATCACCTGAGAGACTTC
AAGGACGTCGAAGATGACTCGGCGATGAAGTTTTGGGGCGAGCACCTGACGGGATGGAACAAGTCCTCTTTCCCG
AAGCTGGCGGCTCAATCCCCTATGTCGAATGAGGTTCAGACAAGGAGCCACACGTTGGAGATACTGCCCGAGCAG
GTAAAGCGAATGGCAGGAGAGTGGGCGGTAGGTGTCCAGGTGCTGTTCCAAGCATCTTTGGCTCTGCTATGGAGT
GGCATCGCTGGAGAGCAAGATATGGTGCTTGGGTCCGTGACTTCTGGGCGGACAATAGCCGTGGATCAAATCGAG
GAGATAGTCGGGCCTTGCATTGCGTCTCTGCCTTTCCGAGTCGATCTCAACAACATGATTTCTGTCAAGGACTTA
CTGCCGTCTGAGAGTCTATACGACATTCTCATCGTCTATCAGGAGTCTCTCGAGAGCTTGAAAAAACAAGACTGG
CTCCTTACCGAACCTCGCGAATCATGTTACAGGATCCAGGCCACCTACCACTCTTCGTTCTTTGCGCCTGGTCTA
GTCGACTGCCTCCTCCAACAGTTCGATGACATGACGGGGATGCTGCTGAAGAGTCCCGATATGTGTCTTCGATCT
GTTCGGTCTGCCATGCCCGGGCTGTCGCTCCATAACGAAGCCGTGCAGCCGTTTCTCGGAGTGCCTGACCTTGCT
GCTCAGTTTGAGGCGACGGCGGCCGCCATGCCTACGGCCGCTGCGTTGTGCTTCTGCGACTCGTTCACCTCTCTG
GGTCCCCGGACGCTGTCGACCTCCTATGAAGAGCTGAATAGAGCTGCTAATCAAGTCGCCCATTATCTGTGCAGT
CAGCTGATCCCGATCGGAGAGGTTCTGGCTGTGCTCATGTCAAAATCTCCCACGTTTTACACCACTGTCCTTGGT
GTTCAAAAGGCAGGATGCGCGTACCTGCCCATTCTTCCCCAGACGCCCGAGGTGCGGGTGCGCACCATTCTCAAG
CAGGCTGGAGTCAAGCACTGCCTCGTTGATAATGCCTCTTTACCGATGTTCTCGCTTGAAGGCGTGCGGATTCAC
GACGTGGAGCGCGTCGAGATGCAGCGTTACTCGCCAGATAATCGGAACATCCCACGCACTGCTTCTCGTCTGGCC
TATGTCATCTACACTTCAGGAACTACAGGGGTGCCGAAAGGCGTTGCTGTCACGCAGGAAAACATCGTCAGCAAC
ATCACAGTCTTGCGATCCATCTACCCCAAGCCCAAGACGGCAGAGCCGCGACTGCTCCAGGCCTGCTCCCAAGCG
TTTGACGTGTCTGTTTTTGAGATATTTTTCGCCTGGCACGCGGGCATGTGCCTGTGTGCAGCCCCGAACGACATC
TTATTCCAAGACCTGGAGCGCTTCATGCGCCTGTTGAAGATTAGCCACTTGAGCTTGACGCCGACGTTGGCCTCG
CTCATAGATGCCGCCAAGGTACCAGGTGTCGAGTTTCTCGTCACTGCCGGCGAGCCGATGACGCTGTCCGTTTTG
GATCGATGGCACGACCGGCTTTGGCAAGGATATGGGCCGTCCGAAACGACCAACATATGCAGCGTGAAGCACATG
GCACGCGGAGAAAACATTGAGCATCTTGGCTGGGCTCTGCCCAACACGTCGACGTTTGTCATGCGGACCATGGCC
GCGGAGACTGTCCCCGTCGGATGGGTGGGCGAACTCTGCTTTGGCGGCCATCAGGTCGCGTGGGGATACTTGAAC
GACACTCGTCTGACGAAGGAGAAGTTTGTCCATCACCCCAAATATGGAAGGATTTACCGTTCTGGAGATCTGGGT
CGAATGCTCCCTGATGGCTCGCTGGTGATCCTTGGCCGGCTCGACGATCAGATTAAGCTGCGAGGCCAGCGGATC
GCAGCCGGCGAAATCAACAGTATCATCACTTCCACCAATCTGGCAACCACTGCCGTGACGGTCTCTGCTCGACGG
CGGAAAGACGCACCAGAGCAGCTGGTGTCGTTCTTCGTCCCCTTTGAAGCCCGAACTGAATACCGGACGATGGAG
ATCTCGCCGGAAGTCAACCGCCATCTCTTCGCAAGCTTGTCATCTCGGGTGCCGCCGTACATGGTGCCATCCTAC
TTGATTCCCGTATCTCAAATACCCACGACGGCTAGTGGCAAGGTAGACTGGCGACGCCTTCGAGAGAGTTTTGAG
GACTTGACCGGGCATCACGCCGAGGCTGCCTCTTCCACCACGCAATGTCTCGATGGCGCGAGCGACTGGACTGTA
AGGGAATCGATTCTTGCCGACGTCATCGCGCGTACGACAAAGGTCCCGCGAGATGAGATAAGACGGTGGACGCCG
TTCGCGGCCCTGGGCGTAGATTCCATTACTGCCATTGACTTGTCTCGCACGCTGGGCTCTCGCCTGGAGACCTGG
GTGTCGATATCCTCCATTCTTCAGAACCCGTCCGTTGCTCAGCTGGCCAAGTCGCTGGAGATGAAGGGAAGGCTC
GGTGACGAAACCGCCTCTCAAAAGTCTGACGCTCTGTTTACAACCTTGTCCGGCGAGGTTGGTACCGCCTTGGGC
CGAGACCCGGGAGATATCGAAGAGATCCTTCCGTGCACGCCACTGCAGGAAGCCATGCTTTCGCAAGGGACGGGA
AGCTATTATAACAAGATCCTGCTGCGACTCCGCATCCAGGCCGATGACCTGAAGGCCTACTGGGATGAGATGTCC
AAACGACACGGAATTCTCAGAACCTGTTTCGTCACGACGCGGCGCGCCGAGCATCCGATTGCGCAAGTAGTCCTG
AGGCGATGGAGGGTGTCGTGGAAGACGTATGACGTTCACGCGCCCTCCCTTGCTGGCGTATCCGACGAGCATCTG
AAGTGCCTTCCGGAGCCCCTGAACTCGGGCCTGCCCCCTCTGTCTTGCGCCTTTATGAGATATAAAGGTTCAACT
TTCTTTTCGCTGATCTGCCATCATGCCATTTATGACGGCGTCGCCATGGACAACCTGTGGCGGGAAATCGAAGCC
TTGGCCAACCAGCGCAGCCTTCCCCCCCCTGTGCCCTACAAGCCGTTCATACAGCACGTTGTCGACGCTCCCGAG
GATGTTGATGTGTTCTGGGCCGAGCATTTCCGCGGCTTCCGGCCTTGCAGGCTCTTCAGACGCTTGGCCGGTGCG
CAGGTGAACCAATGTACTCATACCAGCTCTTTTGGCGTGACGTTGATGGAGGTCCAAGAACGCTTAAGATGGCTC
GGAATCTCTCTTCTCTCTGCATGCCAGACGGCGTGGGCAACACTTCTCTCGGCAGTAAGCGAGAGTCCAGATATT
GCCTTTGGTACCGTCGTCAACGGCCGTATCGCCGACATGGAAGGTCTGGACCGGTTGATTGCCCCCTGCTTCAAC
ACTATTGCGATGCGTGTCGACCTTGCAAGCATTTCCCAGAACATCGAATTAGCCAGACAGTTGCAAGATGTCAAC
GTACAGATGATCCCGTATCAGTTCACGCCATTGCGACAGATTCAGAAGATCGTCAACTGTCAACGTCGGGCATTG
TTTGATACCTTGCTGCTCCTTCAGCAACCACTCAAGGAGATGGACGACAGCGTTTGGACACTCGAAGAGGATTCA
GGAAACATGGACGTCCCGCTGGTGTGCGAGATGGTTCCATGTCCAAACCTCAACTCGATCGTCCTCAACGTCCAT
TATGACATCGGAATCGTCTCCAGGGACGTTACTGCATGTCTGGCCGACATCTTCATATACCTTTTCCGTCGTCTG
ATTGACATGCCGCTCGCGAGCCCAGATGATAAGAGCACCTTACCAGAGGCTCTGAAGTTGGGTCTCGTGGATCTC
GTCCCAAGGCGTGACAGGCCAGAGGGTAAAAGCCGCCGGCGATATGAGGACGAGAGCTGGACCGACACCGAGAAG
GTGATTCGGGGAGTCTTCTCGGAGCTTTCTGGTGTGCCGCAGACAAGGATCGGCCGTGATACCAGCATATTCCAG
CTCGGATTGGACAGCATCAACGCTGTTCAGGTCGCTTCGATGCTCCGGCAGAAGGAATATAGGGTTTCTGCGTCG
GAAGTCATCGAGTGCGCCAGCTGTGCGAATTTGGCCTGTCGACTGCTCTACGCCTTCGAAGAGAAGCTGCCGGAG
ACAACGCAGGCGATCAGCCTGCACAAATTCGCCGACGACGTCTCCTCACAAGTACTTAACGCGATGTCGTCTGAT
AACCAATTTGAGGCCGTTCTCCCTGCCACGCCCATGCAGTCGGCCATGCTGGCCTCATTTCTCTCCTCAAAGGGC
CACAAATACCTCAACATGCTGGCAATGGAGATGGACGACAACATTGGCGTGGAAAGCCTGCATGGGGCTTTCGCA
GTCCTCCAGCGGCAGCATCCGATGCTCCGTACTGGCTTCGTTTCTGTGAGACATAAAGAGAGCTCGTTTGCCATG
GTACGACATGAGGAGGCTTTCGGCGGCTTGCCTGTTGAGAGCATCCATCTCGAGCGGTTTCAGACGTTCGACTTG
TGTGAATGGCAAGAGGTCACTCGGCGAGACATGCTGAAGCTTCTACATCTGCCACTTTGGAAAGCGGTCTTGGTC
AAGCAAGGGGATCGGCTGACGCTTCATCTCACCATGCATCATGCTCTCTATGACGCACACTCGCTAGATGAGCTC
CTACGAAGCCTCTCAAGCCTCCTACTCGATGGCAGAGAGCCTAAATTCTCCAGGGTCGAACCAGCTTTGTTGGAG
GTTCTTGCCCGCGGTCGACAAGGGCAGGCGGCTGCTCAAGAGTTCTGGGAGAAGCATGCGGGCAACGCCGTGGTG
AACAAGTTTCCACTTTTGACGCCTTTGAGAGAAGAGACAACGGGTCTGTCAACCCGCGAAACGTCTTCGTCAATG
TCCTCCAGCTTTCTCTTTAACGCCGCCAAGGACTGCGGTAGCTCAATCCAGGCGTTGGTGCAAGCCGCCTGGACA
CGCGTTCTGGCCTCGTATCATGGCGAGAGCTCGGTTGTATTTGGGATCACAATGTCAGGGCGTATCACCGACCAC
GGTCGAGCCGCTCCGTTTCCCTGCATCGTCACCATCCCAGTTGTGGCGCGTAACATGGAGTCAAACAGACAGCTT
GTCGAAGCAATGATGGAGTATAATGCCGAAATGCACAAGCATCAGTTCACCCCGTTGAGTCGGATCCAGAAATGG
TTAGGTCATCCTGCCACTTCCGTCTTCGACACGCTTGTTGTCTATCAAAAGAGAGACGGACCGAAGACGGCACGC
CCGCCTTGGAGGTTGGTCAAGGATGAAGCGGTTGTTGACTACGCCGTCTCTCTCGAGGTCGAGCCGAATGCTGAG
GATGATGATAAACTATGCCTCCGGCTCACCTTTGCCAGAAACCTCATACCGGAGGAACAGGCGCACCTCATCGTT
CAACAGTTCGACGCCACACTGCATCATCTGGCCAGCGAGCCTACCGGGAACGAAGATGGACTCTACAGAAAGCGA
CCTGATCTTTTCGCAGTCACCCCGGCTTCGATGCCAGACATGCCTGCTCCGGTACAATTTCTTCATGAGTTCGTG
GAGTATAGCTGCAGGACTTGGCCAGAAACAACGGCCTTGGAGTTTGTGGACGACTGGGACAGAAAGTCGGGCACG
AAAAGATGGAGCTACAGAGAACTCGATCTGATGGGAAACCGCGTCGCTCATCAGCTGCGAGAGCATACCCTTCCC
GGAGACGTGGTGGCACTTCACTTTCAGAAATGCGCCGAGGCGTATTTTTCGATCCTCGGTGTCCTCAAAGCCGGC
TGTGCATTCGTCGCCCTCGACCCTCATGCTCCGAAGGCAAGGAAGAACTTCATCTTGAATGATTCACGTGCGAGG
TGCCTTTTAGCGGAGGACGGAGTGGTGATAGATGTCGACGTTCCCATCAAAGTGCTGGGAATCGCCGAGGAAACG
CTTCGAAAGCTGTCGTACGAGCGTCCGTCTTGGGTCGGGAGCAGTCTGACGCCTGCCCACACCTGCTATTGTCTT
TACACGTCCGGCACGACGGGGACGCCCAAAGGATGCGAGATCAGTCACGAGAATGCGGTCCAGGCCATGATGGCC
TTTCAAGACCTGTTCCAAGGGCACTGGGACGCCGACTCGCGCTGGCTGCAGTTTGCGGCGCTTCACTTTGACGTC
TCCATGCTCGAGCAGTACTGGAGTTGGGCAGTGGGCATCACGGTCGTGTCCGCGCCCCGAGATCTGATCCTGGAC
GACCTCGCCGGGGCAGTTAGGAGGCTCGGCATCACCCATGTCGACCTCACCCCTAGTCTGGCCCGGCTGACGAGT
CCTGAGGAGATGCCGAGTCTGCGCGTCTTCATCACGGGAGGAGAGCAACTGAAGCAGGAGATTCTCGATAAATGG
GGCCCAAAGGCCGTCATCTACAACGCCTACGGCCCTACGGAGGCGACCATCGGCGTGACCATGTGTCCGCGCGTG
CCCGTCAACGGACGCCCGAGCAACATTGGTAAACAGTTTCTCAATGTCGGCTCTTACGTCTTTCGTCCATTGACC
GAGACTCCTGTCCTACGAGGTGCCGTCGGGGAGCTGTGCGTGTCAGGCAAGCTGGTGGGCAAGGGATACCTGCGC
CGTCCAGAGCTCACCAAGGAGCGGTTCCCGACGCTCGTCGAGTTTGGTGAAAGGGTCTACAGGACGGGCGACCTG
GTGCGGATCCTCCACGACGGATGCTTTGAGTTTCTTGGCCGCGCAGACGATCAGATCAAGTTGCGCGGACAGCGG
CTGGAGATGGGCGAGATTAACCACGCAATCCGCTCAGGGGCGGCGGGCGTTCTCGATTGTGCAACGCTCTTGGTG
CACAGAGAGACTCCGGACAAGGATGTCTTGGTGTCCTTTGTTGTCGGACGGGCGTCAACCGGCCGTCAAAGGCTC
TCCACGTTGCAAGACCCCGACGGACTTGGTGCTCAAGCAAGAACGGCTTGTCTTGGGAGGCTGCCGGCCTACATG
GTGCCAACATATTTCCTCCGGCTGCCGTACATACCTCTCTCGCCGAACAACAAGGTCGAAGCTAAAGAGCTCAAG
TCGTTGTTTCAGTCTCTCTCGCATGAGGAGCTGATGAAGCTGTCGGCCGCTGCTGTGGCTCTCCCGACGAGCCTC
GACGAGGCCGGCACTGGCAGCATCATCAGCATCGTGTCCGAGTTTAGCGGCGTCGCAGAAGACAAGTTCACGCCG
TCGACCAGCCTGTTCGACGTCGGCGTGGACTCCATCACCGCCCTGCAATTGACCGCCCGGCTTCGCGAACGAGGT
TTCCGGGCTGCCTCTCCCGCTGTGTTGCTGAAATGGCCCATCATCGCGCACCTCGTCAAAGCCCTGGCCGACAAC
TCCTCAGAAGTAGCAAGCATCATGGTTAGCGGTGTGAGGGAAGCTAAACAGCTCCTGCAGGCCTGTCACTACAGA
TATCTCCCATTCGTGTGCCGCGAGCTGGACGTGGGGCCTGATGAGGTTGAATATATTGCGCCGTGCTCGCCGCTG
CAACAGGGCATCATCTTCAAAGCTCTCAGTAACGAGAGCTCCGACCCTTACTTTTCCTCTTTCGAGCTGAGACTG
GATAGAGGCGCCTCGGTTGACAGAGTCCGCGACGCCTGGAGTCGGACTGTTGATGCTCACGCCATACTTCGATCT
GTTTTTGTCAACACCCCTGATGGGCATATTCAGGTCGCAATGCGTCAGACAAAGGGTCAATGGCAAGACGTGAAA
TTTGAATCTCAAGACGAACTCTTTCTCACCATGGAAACGAAAAGGCGAGATTGGGTTGCGAAAAACAGGCATCAC
TTTGGCCGCCCCATCGAGCTCATTCACGCGCAGGGGCCGGACTCTCAGAGGCTCTTCCTCCACATCTTCCATGCG
CTCTACGACGGCAGCAGCTTGCGACTCATCAGCCACTATGCCAAGGCCCTGTACCGCGACGAGCAACCGCCGTCA
AGCCCCCCATTTATCGAGGCCTTGAGCCACGGGCCGCTCTCAAGACACGATCAGTGCCGACAGTTTTGGACGGAG
CACATGCGTGGCTGGACACCGTCACCAGTGCCGACGCTCGCAGCATCGTCAGACGAACTCAGAGGCGTGACAGTC
AGTCGCAACGTTCCGCTGGCCCTACTCGAGGGGCTGCGACGTCAACAAAACGTCACGATGCAGTCTGTCGTGCTC
GCCCTGTGGACTTCGGTCCTCCAGAGATGTCTGACCAGCAGCGTCACAGTTGGCGTCATTCTTTCAGGCAGGTCT
ATTGACCTTGCTGGGGTCGAGCGGACAATCGGCCCTCTGTTCAACACCGTGCCCTTCTTCGTCGACGCCCTGCGA
GAGCGCACTTGGTCGTCGTTGATCCGCGAGGCCCATGGCTTCAGCACTTCGGTAATGCCTTTCCAACATGTGCCC
CTGAAGGACATCCAGTCATGGTGCTCTGGAGGCCGTCCGCTTTTCGACAATCTCTTTGTGTTCCAGCTTGAACAG
CCTGAATGGTGCGACGAAGCTGCGCTTTGGGAGGTCGAAGACGGTCCGGATCGCCCCGATTACCCCCTGGCGCTC
GAAGCGACGCGAACATTAGGGGGGAACTTACGGCTATGCCTTGTGTCGCAAAGCCGGTATGCTGATGCAGTCATG
CTGGAGGGCATGCTGGACCAATTCGAACAGGTGATGGCGACAGCCGAGGCGGAGGCAACGGGGAGTCCTTGGCAA
GGCGCTACAGAGCCCAATCAGGGGGTGTTAGTCGGGAACTCTGGAGAGGAAGAGGCGGAGGTCATGTTCGACTGG
ACGGAGGAAGCTGTTGTGGTGAGGAATGAGTTGGCGCTACTTGCCCGCATACCCCCTGAACAAGTCGGCGCAACA
ACTATGCTGCTGGAGCTGGGCCTTGACAGCATTGATGCGATGAAGCTCTCAACAAGGCTGAAGCAGCGTGGAATC
AACGTATCTGCGTCAAACATACTGCGAAGCCAGACGATAGCCCGTCTCGTTGGTCAGCTGGAGATGAGCGGCGTT
GCGCTTCCATCCAACTCTGAGTCTTCGAAACTCCTCGAAGAGATAAGATCTAGGCTCTGGATCGAGGTAGAGAAT
GGTGTGACAGACGCGAAAATGGTTGAGTCGGTCTTGCCTCCGACTCCTCTCCAGGAAGCCATGGTTTCGGGCATG
GTTCAGTCAGGCTTTCAGTGGTACTTCAACCACGATATCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTT
GGTGCCGCGTGGAGGCAGCTGATCGAGGCATCGCCATGCTTGAGAAGCGGCTTCATCGAAGTTGGCGACTCGAAT
CTGGACGTGTCGTACTGCCAAGTCACCTTCAAGAGCAGAACTTGTTGCGTCAAGACGCGGGCGCTGGCGGACAAG
TCTGAGATGGGACAGGTGATGCTGGACGCGACGCGGCTGGCTGCTCAAAGCAAGGGACTGCAAGACTTGGTGCAG
ATTGCGCTGGTGACGGTTGGCGAGCGACGTCTCGTTGTCGTTTCCATGGCTCATGCTCTCTACGACGGTTGGTCG
CTCGGGCTCATGTATCGGGATCTGGAAGAGCTGTACTGGGGGCGGGAGAGGAAGACACAACAAACATCCACCGAT
GCTTTTGTTGGGCGCGTTCTGGCCTGCAGGACGGAAGAGGCCCGCGGTTTCTGGACTGGTCATCTCGCGGGCCTT
CGGCCGACTTTGTTGACAGGAAGGGCGAAGACGACAACGAAAACAGGAGACTGGCCGTTGCGCAAAGAAGCTCCG
TCCGGCTGCAGTCTCTCTCAACTAACAAGCTTCTGCAAGAGGCAGGCAATCAGTCTACAGGTGCTCTGCGTCGCC
ACATGGGCTGTCGTCGTGGCGGAGCGAACCAGGGGCCTCGATGTCGTCTTCGGACTCGTGCTGTCTGGCAGAGAC
GGAGAGGGGACGGAGGAGCTGATGTTGCCGACCATGAGCACAGTGGCCTTGCGCTGCGTCCTTCACGGCTCCGTC
TCCAGCTTCCTCAAATATGTGGAGGAGACGGTGACGGATGTCAGGGGCTATCAGCATTACCCCCTGCGCAGGGTT
CAAGCTGCGGAGGCCTTTAACTCGCTTTTCCTATTCCAAAAGACGCCCAGACAGAATGAGGCGTCGACCCGGCTG
TTTCGGTCCATCGACGGCCAGTCAGCTGTCGAATATCCGGTCTGTGTCGAGGCCGAGCCCGTCGACGATGGACTT
GTTTGGCGTGTCGCCTGCCACCGACAACTCTTCTCCAGCCAAGACACCCAGCTGCTACTCAGTAGGTTGGATCAG
GTGCTACAGTACATGTTTGACCACGAGGCCATTGCTGTCCTCTCCTTCGAGGATGAGGGCGTGTCGATTTGCGGG
CTGCCGGTGCTGGAGGTCGAGGAAGGGCGTGTCCTCGACTGCCGGCCCGACGTGACCGACGACCAGCCAAGCGAG
CAGGAAACCTGGGGAGACACGGCTACTGCAATTCGCCATGTCTTGAGCCAGGTTTCGGACATGCCAGTCGAGTCG
ATAACGCTTCGATCCAGCCTGTACCAGCTCGGCCTCGACTCCATCAGTGCCGTCAAGGTGTCGATGCTACTCCGC
AAGAGAGGAATCGAACTAAAACCGAGGCAGCTCGTCAAGCTGTCGAGCTTGAGGGAAATGGCAGACAACGTGACG
CTCGCAGGACAAGACACTAAGAAGCAGAAGTCCCATCCGGGAGTGACGTGGAAGCCCCCTAGGTCCATGGACGTG
GACGAGCTGCTCCGAGAGTGTAACGTGCCGAGAGACTGCGTCGAGGCGGTGCTGCCAGCGACGCCGATGCAGGCG
TACATGCTGACGGCATGGGAGAAGCCAGGCGGCGCCGTCTTCTTCCCAGAGTTTCACTACCGTATGGACGGCACT
GATGACGTGTTGAGGGCCCAAGAGGCATGGAAGATGCTCAGCGACCAGACGGCCGTGCTGCGAACACGCTTCTTG
GCCACCGGCTTTGATGAGGTACCGTGGATCCAGGCGGTGATGCACAAGGAGGCCATCCGATCCGGCCGCATATCA
CAGCCCCTGGTCCGTCTCGACATCAACAAGGCCGACTCGGGCAAGGGACTGGAGCTGCGACTCAAGATACACCAT
GCCCTGTATGATGAACTCAGCCTGGCAGCCCTGACTTCGCAGCTGTGCGAGCTTGTGAACAGCACGGCAGCCCCT
GAGAGCGACGACGACGACGACGACGACGACGACGACGACGACGGTTTCTCACGGTGGGCGCTCTACTGCAATGCT
CTGCCGGACGGCCGGGCCAGACGGCGAGAGTTCTGGACCGAGTATTTGAGGGGAGGCACCGCCGTCGACATTGAA
GCGTCTTCGGCGACCGACACGGCCGAGAGAGCGTCCTACCTCGACAAGTCAGCCGTGAACGACGTGACGGATCTA
CGGGCAACGGCCTCACAGCACAGCATAAGCCTGCAAGCACTCGTCTTAGCCGCGCTGGCGAAGAGCCTGGCCGGA
CGAGACTCGGAGCGTGCAATCATCCTGGGCATCTACCTCGCCAACCGAGCCGGCGGCGAACGAGACTCGCCACCT
GCGACGTGTCCGACGCTCAACCTAGTGCCGGTCAAGGTGCAGCCAAGTCCGGGCCTCCGTCTTGTCGACATGGCG
AGGGCGATTCAAGCCGATGTCGTCAGCATAGGCGACGACGGACGAGCCCAAGTCGGGCTCTGGGAGATTCTGGCC
TGGACGGGCGTCCGGATCGGCTGCTTCGTCAACTTTCTCGTCGGCGGCGCCAAGGTGGACCGCGTCGGGGATGTC
GTCACTCTCCGTTCCGTACAAGGAGACGTCATGCCCATCATGGTGATGGGAGAAGCGTCGCCGCGCGGGCCCAGG
AGGAACGTGGTTAGCGACGCGGTCGAGCCTTCGGTCGACATCGAGGCCTCGGTCAGCGGGGACAAGGCTCTCGCC
GTCGGAGTCTTTGGCCCGAGGGGGCGCGTGACGGACGAGTGGGCCGCCAAGCTGGTTGCCGATACGGTTGCGTTC
CTGGCCGAGGCGGGCGCGGGCGGTTAG
Gene >Ophio5|1454
ATGGCCGCCCAAGGCTTGTCCATCATCAATCCGCGTCCAACCAGGTTGTTGGGTCCAAGCTTGCTTCATCAGCTA
ATCGCTCCGCCTTCCGAACACTTAGCTCTTGATCAGCTGGGCCAGGACGGGAAATGTTCATACACGTATCGAGGC
TTGCACAACGCCGCTGCAGCCATCGCCAGTCTCCTCGTTGACGTCCGTTCATCGGTTGCACGGAGCCGCACTCCA
TTCGTCGTCCCTGTACTCATCCCGCAGTCGTCCTTACTTTGCATCTCTCTGCTCGCCGTTCTCAAAGCTGGCGGT
GCCTTTTGTCCTCTCAACCTCGATGCCCCTCGTGAGAGAATCAAGTTTATTCTTAACGATGTCTCCGCCACTGTC
GTCCTCGTCTCACGCTCCACGGCGCATTTGGTGCCCGCGGAAAACCATGTACAAGTTATAATGGTGGATGACATC
GACAATGGGAAAACTTCCATGCCAACTCCTGATCATCAGGAGCCTACTCCAGAGGACGTGGCCTATGTCATGTAC
ACGTCTGGATCGACCGGGACGCCCAAAGGCGTATGTATCCCTCATGATGCCGTAACGCAAGCCCTCCTTGCCCAC
GACCGTCACATACCGGCCTTTTCCAGGTTTCTGCAATTCGCCGCACCTACGTTCGACGTCTCAGTCTTCGAAGTC
TTCTTCCCCCTTTTTCGCGGTAGCACCCTGGTCACTGCCCGCCGCGATGAGCTGCTGGATGACCTGCCATCGGTT
CTTCGGAAGATGAACGTCGATGCCTGCGAGTTGACGCCCACAGTCGCTGCGAGCCTGCTCAGAAGACGCCAGAAT
GCGCCCGCTCTCAAGCTTCTCCTGACCATAGGCGAGATGCTGACCCTCCCCGTCGTCGAGGAGTTTGGCGGGTCT
GAAACAAGGCCCAGCATCCTCTGGGCCATGTATGGGCCAACAGAAGCAACCATTCATTGGTGAGACACAATCCGC
CACCGTTGCCTGCCTTTGTAGATTCTGACCTGGTAAACAGCACGCTGCAGGCCGCCTTGACGTCTGAGTCATCAA
CAGGGAACATTGGAAGCCCCCTTGATACAGTTTCCTGCTTCGTCGTTGAGCCTCGGGCCTCTGGCCATGACCAAA
GCGCCTTCAAAGTTCTCCCGCAGGGCGAAGTCGGTGAATTGGCCGTCGGCGGCTACCAGTTGGCCCGCGGTTATC
TAAACCGCCCAGAACAAACAGCTTCTGCTTTCATCACCACTCCTTACGGTCAGGTTTACCTTACGGGAGACAAGG
CTCGCGTGACGCCTGATGGAAAGCTCGAATGTCTCGGTCGCTTGACGAGCGGGCAGGTGAAGCTGCGTGGCCAGC
GCATCGAGACTGGTGAGGTGGAACAGTCGGCTCTGAAGACACCAGGCTGCCATGGCGCTGTAGCAGCCGTCGTTG
ACGCCAGTTTGGTCCTATTCTGCGCCGTCGATCCAGGCACTTCTGAGGATGCCATTGCCACGAGCTGCAGCAACT
GGTTGCCCGGCTTCATGGTCCCAGGGGAGATTGTCTTGATGGTTGAGTTTCCTCGCTTGCCAAGTGGAAAGATCG
ATGCACAGAAGCTCAAGTCAATCTATCAGGAGCAGAAGTTGGCCGAATTTTCTGAGCACGACGAGATGGTGCTCG
CTGAGGAGGAAGTGATTCTTCATGTGATCTCGTCTGTTTTGGAACGACAAGTAAGCAAGCAGATGACACTGGCCT
TTGCCGGCGTAGATTCACTTTCAGCAATCAAGCTGGCGTCTGCGCTGCGACTGTCAGGCTTCGGGATGAGTGCCT
CTGATATGCTGAAACTGAAGACAGTAGCAGACCTTTGCTGTCATATTCGCAAACGACCCATGATGAAGCTGTCGA
ACCATGAAGTTTTCAGTGTAAGCATACTGGCCGACTGGGGCCATATCCTTGCTCAGAACCCCGGATTGGACCTGG
CAAAAAGAAACATGGATGACGTTATCCCCTGCACTTCGCTTCAAACGGCTTTGTTGGCTGAGACGGCGCGCGATC
CCCAGCTCTATTGCAACCAGCTCGAGTTTCAGGTCGCACCAGGATATACAGTCAGCGACGTTGCGGATGCAATCT
GCCAAGTTGCGGCGGAAAACGAAGTCCTCCGCTCAGGCTTCGTTTCGTTGCGTGGTGGATATGCTGTCGTCTTGT
TCAGGGACTTTGGGACCGACGATAACCTCCGCGTCGTGCCACAGTTTGACGAGAGCTTTTCGTTTCTGCATCCGC
ACGACTTCCTTAAGCCATTCCGAGTTCAGATCTGCAACAAGGAGAAGGATGCTGGACTTCGAGTTCTTTTCCAGG
TTCATCACGCCGTCTACGACGGTTGGTCCATGGATCTGATCTTGTCCGACTTGTCCGCGCTGCTGCGACGTGTTC
CGCTCTCACCGCGTCCGCAGTTCCGGGAGGTGTTGCGACATCACCTGAGAGACTTCAAGGACGTCGAAGATGACT
CGGCGATGAAGTTTTGGGGCGAGCACCTGACGGGATGGAACAAGTCCTCTTTCCCGAAGCTGGCGGCTCAATCCC
CTATGTCGAATGAGGTTCAGACAAGGAGCCACACGTTGGAGATACTGCCCGAGCAGGTAAAGCGAATGGCAGGAG
AGTGGGCGGTAGGTGTCCAGGTGCTGTTCCAAGCATCTTTGGCTCTGCTATGGAGTGGCATCGCTGGAGAGCAAG
ATATGGTGCTTGGGTCCGTGACTTCTGGGCGGACAATAGCCGTGGATCAAATCGAGGAGATAGTCGGGCCTTGCA
TTGCGTCTCTGCCTTTCCGAGTCGATCTCAACAACATGATTTCTGTCAAGGACTTACTGGTGAGCATCCAAACAA
GCAACCGGGCAATCATGCAACACAGCGCGCTGCCTCTTGCGGAAGTCAGAAAACTGGCAGGACTTCAGCCGTCTG
AGAGTCTATACGACATTCTCATCGTCTATCAGGAGTCTCTCGAGAGCTTGAAAAAACAAGACTGGCTCCTTACCG
AAGTACATCACTTGGATCGTCTGGAGACGAAACTCTTGCTTGAGATACAGCCTCGCGAATCATGTTACAGGATCC
AGGCCACCTACCACTCTTCGTTCTTTGCGCCTGGTCTAGTCGACTGCCTCCTCCAACAGTTCGATGACATGACGG
GGATGCTGCTGAAGAGTCCCGATATGTGTCTTCGATCTGTTCGGTCTGCCATGCCCGGGCTGTCGCTCCATAACG
AAGCCGTGCAGCCGTTTCTCGGAGTGCCTGACCTTGCTGCTCAGTTTGAGGCGACGGCGGCCGCCATGCCTACGG
CCGCTGCGTTGTGCTTCTGCGACTCGTTCACCTCTCTGGGTCCCCGGACGCTGTCGACCTCCTATGAAGAGCTGA
ATAGAGCTGCTAATCAAGTCGCCCATTATCTGTGCAGTCAGCTGATCCCGATCGGAGAGGTTCTGGCTGTGCTCA
TGTCAAAATCTCCCACGTTTTACACCACTGTCCTTGGTGTTCAAAAGGCAGGATGCGCGTACCTGCCCATTCTTC
CCCAGACGCCCGAGGTGCGGGTGCGCACCATTCTCAAGCAGGCTGGAGTCAAGCACTGCCTCGTTGATAATGCCT
CTTTACCGATGTTCTCGCTTGAAGGCGTGCGGATTCACGACGTGGAGCGCGTCGAGATGCAGCGTTACTCGCCAG
ATAATCGGAACATCCCACGCACTGCTTCTCGTCTGGCCTATGTCATCTACACTTCAGGAACTACAGGGGTGCCGA
AAGGCGTTGCTGTCACGCAGGAAAACATCGTCAGCAACATCACAGTCTTGCGATCCATCTACCCCAAGCCCAAGA
CGGCAGAGCCGCGACTGCTCCAGGCCTGCTCCCAAGCGTTTGACGTGTCTGTTTTTGAGATATTTTTCGCCTGGC
ACGCGGGCATGTGCCTGTGTGCAGCCCCGAACGACATCTTATTCCAAGACCTGGAGCGCTTCATGCGCCTGTTGA
AGATTAGCCACTTGAGCTTGACGCCGACGTTGGCCTCGCTCATAGATGCCGCCAAGGTACCAGGTGTCGAGTTTC
TCGTCACTGCCGGCGAGCCGATGACGCTGTCCGTTTTGGATCGATGGCACGACCGGCTTTGGCAAGGATATGGGC
CGTCCGAAACGACCAACATATGCAGCGTGAAGCACATGGCACGCGGAGAAAACATTGAGCATCTTGGCTGGGCTC
TGCCCAACACGTCGACGTTTGTCATGCGGACCATGGCCGCGGAGACTGTCCCCGTCGGATGGGTGGGCGAACTCT
GCTTTGGCGGCCATCAGGTCGCGTGGGGATACTTGAACGACACTCGTCTGACGAAGGAGAAGTTTGTCCATCACC
CCAAATATGGAAGGATTTACCGTTCTGGAGATCTGGGTCGAATGCTCCCTGATGGCTCGCTGGTGATCCTTGGCC
GGCTCGACGATCAGATTAAGCTGCGAGGCCAGCGGATCGCAGCCGGCGAAATCAACAGTATCATCACTTCCACCA
ATCTGGCAACCACTGCCGTGACGGTCTCTGCTCGACGGCGGAAAGACGCACCAGAGCAGCTGGTGTCGTTCTTCG
TCCCCTTTGAAGCCCGAACTGAATACCGGACGATGGAGATCTCGCCGGAAGTCAACCGCCATCTCTTCGCAAGCT
TGTCATCTCGGGTGCCGCCGTACATGGTGCCATCCTACTTGATTCCCGTATCTCAAATACCCACGACGGCTAGTG
GCAAGGTAGACTGGCGACGCCTTCGAGAGAGTTTTGAGGACTTGACCGGGCATCACGCCGAGGCTGCCTCTTCCA
CCACGCAATGTCTCGATGGCGCGAGCGACTGGACTGTAAGGGAATCGATTCTTGCCGACGTCATCGCGCGTACGA
CAAAGGTCCCGCGAGATGAGATAAGACGGTGGACGCCGTTCGCGGCCCTGGGCGTAGATTCCATTACTGCCATTG
ACTTGTCTCGCACGCTGGGCTCTCGCCTGGAGACCTGGGTGTCGATATCCTCCATTCTTCAGAACCCGTCCGTTG
CTCAGCTGGCCAAGTCGCTGGAGATGAAGGGAAGGCTCGGTGACGAAACCGCCTCTCAAAAGTCTGACGCTCTGT
TTACAACCTTGTCCGGCGAGGTTGGTACCGCCTTGGGCCGAGACCCGGGAGATATCGAAGAGATCCTTCCGTGCA
CGCCACTGCAGGAAGCCATGCTTTCGCAAGGGACGGGAAGCTATTATAACAAGATCCTGCTGCGACTCCGCATCC
AGGCCGATGACCTGAAGGCCTACTGGGATGAGATGTCCAAACGACACGGAATTCTCAGAACCTGTTTCGTCACGA
CGCGGCGCGCCGAGCATCCGATTGCGCAAGTAGTCCTGAGGCGATGGAGGGTGTCGTGGAAGACGTATGACGTTC
ACGCGCCCTCCCTTGCTGGCGTATCCGACGAGCATCTGAAGTGCCTTCCGGAGCCCCTGAACTCGGGCCTGCCCC
CTCTGTCTTGCGCCTTTATGAGATATAAAGGTTCAACTTTCTTTTCGCTGATCTGCCATCATGCCATTTATGACG
GCGTCGCCATGGACAACCTGTGGCGGGAAATCGAAGCCTTGGCCAACCAGCGCAGCCTTCCCCCCCCTGTGCCCT
ACAAGCCGTTCATACAGCACGTTGTCGACGCTCCCGAGGATGTTGATGTGTTCTGGGCCGAGCATTTCCGCGGCT
TCCGGCCTTGCAGGCTCTTCAGACGCTTGGCCGGTGCGCAGGTGAACCAATGTACTCATACCAGCTCTTTTGGCG
TGACGTTGATGGAGGTCCAAGAACGCTTAAGATGGCTCGGAATCTCTCTTCTCTCTGCATGCCAGACGGCGTGGG
CAACACTTCTCTCGGCAGTAAGCGAGAGTCCAGATATTGCCTTTGGTACCGTCGTCAACGGCCGTATCGCCGACA
TGGAAGGTCTGGACCGGTTGATTGCCCCCTGCTTCAACACTATTGCGATGCGTGTCGACCTTGCAAGCATTTCCC
AGAACATCGAATTAGCCAGACAGTTGCAAGATGTCAACGTACAGATGATCCCGTATCAGTTCACGCCATTGCGAC
AGATTCAGAAGATCGTCAACTGTCAACGTCGGGCATTGTTTGATACCTTGCTGCTCCTTCAGCAACCACTCAAGG
AGATGGACGACAGCGTTTGGACACTCGAAGAGGATTCAGGAAACATGGACGTCCCGCTGGTGTGCGAGATGGTTC
CATGTCCAAACCTCAACTCGATCGTCCTCAACGTCCATTATGACATCGGAATCGTCTCCAGGGACGTTACTGCAT
GTCTGGCCGACATCTTCATATACCTTTTCCGTCGTCTGATTGACATGCCGCTCGCGAGCCCAGATGATAAGAGCA
CCTTACCAGAGGCTCTGAAGTTGGGTCTCGTGGATCTCGTCCCAAGGCGTGACAGGCCAGAGGGTAAAAGCCGCC
GGCGATATGAGGACGAGAGCTGGACCGACACCGAGAAGGTGATTCGGGGAGTCTTCTCGGAGCTTTCTGGTGTGC
CGCAGACAAGGATCGGCCGTGATACCAGCATATTCCAGCTCGGATTGGACAGCATCAACGCTGTTCAGGTCGCTT
CGATGCTCCGGCAGAAGGAATATAGGGTTTCTGCGTCGGAAGTCATCGAGTGCGCCAGCTGTGCGAATTTGGCCT
GTCGACTGCTCTACGCCTTCGAAGAGAAGCTGCCGGAGACAACGCAGGCGATCAGCCTGCACAAATTCGCCGACG
ACGTCTCCTCACAAGTACTTAACGCGATGTCGTCTGATAACCAATTTGAGGCCGTTCTCCCTGCCACGCCCATGC
AGTCGGCCATGCTGGCCTCATTTCTCTCCTCAAAGGGCCACAAATACCTCAACATGCTGGCAATGGAGATGGACG
ACAACATTGGCGTGGAAAGCCTGCATGGGGCTTTCGCAGTCCTCCAGCGGCAGCATCCGATGCTCCGTACTGGCT
TCGTTTCTGTGAGACATAAAGAGAGCTCGTTTGCCATGGTACGACATGAGGAGGCTTTCGGCGGCTTGCCTGTTG
AGAGCATCCATCTCGAGCGGTTTCAGACGTTCGACTTGTGTGAATGGCAAGAGGTCACTCGGCGAGACATGCTGA
AGCTTCTACATCTGCCACTTTGGAAAGCGGTCTTGGTCAAGCAAGGGGATCGGCTGACGCTTCATCTCACCATGC
ATCATGCTCTCTATGACGCACACTCGCTAGATGAGCTCCTACGAAGCCTCTCAAGCCTCCTACTCGATGGCAGAG
AGCCTAAATTCTCCAGGGTCGAACCAGCTTTGTTGGAGGTTCTTGCCCGCGGTCGACAAGGGCAGGCGGCTGCTC
AAGAGTTCTGGGAGAAGCATGCGGGCAACGCCGTGGTGAACAAGTTTCCACTTTTGACGCCTTTGAGAGAAGAGA
CAACGGGTCTGTCAACCCGCGAAACGTCTTCGTCAATGTCCTCCAGCTTTCTCTTTAACGCCGCCAAGGACTGCG
GTAGCTCAATCCAGGCGTTGGTGCAAGCCGCCTGGACACGCGTTCTGGCCTCGTATCATGGCGAGAGCTCGGTTG
TATTTGGGATCACAATGTCAGGGCGTATCACCGACCACGGTCGAGCCGCTCCGTTTCCCTGCATCGTCACCATCC
CAGTTGTGGCGCGTAACATGGAGTCAAACAGACAGCTTGTCGAAGCAATGATGGAGTATAATGCCGAAATGCACA
AGCATCAGTTCACCCCGTTGAGTCGGATCCAGAAATGGTTAGGTCATCCTGCCACTTCCGTCTTCGACACGCTTG
TTGTCTATCAAAAGAGAGACGGACCGAAGACGGCACGCCCGCCTTGGAGGTTGGTCAAGGATGAAGCGGTTGTTG
ACTACGCCGTCTCTCTCGAGGTCGAGCCGAATGCTGAGGATGATGATAAACTATGCCTCCGGCTCACCTTTGCCA
GAAACCTCATACCGGAGGAACAGGCGCACCTCATCGTTCAACAGTTCGACGCCACACTGCATCATCTGGCCAGCG
AGCCTACCGGGAACGAAGATGGACTCTACAGAAAGCGACCTGATCTTTTCGCAGTCACCCCGGCTTCGATGCCAG
ACATGCCTGCTCCGGTACAATTTCTTCATGAGTTCGTGGAGTATAGCTGCAGGACTTGGCCAGAAACAACGGCCT
TGGAGTTTGTGGACGACTGGGACAGAAAGTCGGGCACGAAAAGATGGAGCTACAGAGAACTCGATCTGATGGGAA
ACCGCGTCGCTCATCAGCTGCGAGAGCATACCCTTCCCGGAGACGTGGTGGCACTTCACTTTCAGAAATGCGCCG
AGGCGTATTTTTCGATCCTCGGTGTCCTCAAAGCCGGCTGTGCATTCGTCGCCCTCGACCCTCATGCTCCGAAGG
CAAGGAAGAACTTCATCTTGAATGATTCACGTGCGAGGTGCCTTTTAGCGGAGGACGGAGTGGTGATAGATGTCG
ACGTTCCCATCAAAGTGCTGGGAATCGCCGAGGAAACGCTTCGAAAGCTGTCGTACGAGCGTCCGTCTTGGGTCG
GGAGCAGTCTGACGCCTGCCCACACCTGCTATTGTCTTTACACGTCCGGCACGACGGGGACGCCCAAAGGATGCG
AGATCAGTCACGAGAATGCGGTCCAGGCCATGATGGCCTTTCAAGACCTGTTCCAAGGGCACTGGGACGCCGACT
CGCGCTGGCTGCAGTTTGCGGCGCTTCACTTTGACGTCTCCATGCTCGAGCAGTACTGGAGTTGGGCAGTGGGCA
TCACGGTCGTGTCCGCGCCCCGAGATCTGATCCTGGACGACCTCGCCGGGGCAGTTAGGAGGCTCGGCATCACCC
ATGTCGACCTCACCCCTAGTCTGGCCCGGCTGACGAGTCCTGAGGAGATGCCGAGTCTGCGCGTCTTCATCACGG
GAGGAGAGCAACTGAAGCAGGAGATTCTCGATAAATGGGGCCCAAAGGCCGTCATCTACAACGCCTACGGCCCTA
CGGAGGCGACCATCGGCGTGACCATGTGTCCGCGCGTGCCCGTCAACGGACGCCCGAGCAACATTGGTAAACAGT
TTCTCAATGTCGGCTCTTACGTCTTTCGTCCATTGACCGAGACTCCTGTCCTACGAGGTGCCGTCGGGGAGCTGT
GCGTGTCAGGCAAGCTGGTGGGCAAGGGATACCTGCGCCGTCCAGAGCTCACCAAGGAGCGGTTCCCGACGCTCG
TCGAGTTTGGTGAAAGGGTCTACAGGACGGGCGACCTGGTGCGGATCCTCCACGACGGATGCTTTGAGTTTCTTG
GCCGCGCAGACGATCAGATCAAGTTGCGCGGACAGCGGCTGGAGATGGGCGAGATTAACCACGCAATCCGCTCAG
GGGCGGCGGGCGTTCTCGATTGTGCAACGCTCTTGGTGCACAGAGAGACTCCGGACAAGGATGTCTTGGTGTCCT
TTGTTGTCGGACGGGCGTCAACCGGCCGTCAAAGGCTCTCCACGTTGCAAGACCCCGACGGACTTGGTGCTCAAG
CAAGAACGGCTTGTCTTGGGAGGCTGCCGGCCTACATGGTGCCAACATATTTCCTCCGGCTGCCGTACATACCTC
TCTCGCCGAACAACAAGGTCGAAGCTAAAGAGCTCAAGTCGTTGTTTCAGTCTCTCTCGCATGAGGAGCTGATGA
AGCTGTCGGCCGCTGCTGTGGCTCTCCCGACGAGCCTCGACGAGGCCGGCACTGGCAGCATCATCAGCATCGTGT
CCGAGTTTAGCGGCGTCGCAGAAGACAAGTTCACGCCGTCGACCAGCCTGTTCGACGTCGGCGTGGACTCCATCA
CCGCCCTGCAATTGACCGCCCGGCTTCGCGAACGAGGTTTCCGGGCTGCCTCTCCCGCTGTGTTGCTGAAATGGC
CCATCATCGCGCACCTCGTCAAAGCCCTGGCCGACAACTCCTCAGAAGTAGCAAGCATCATGGTTAGCGGTGTGA
GGGAAGCTAAACAGCTCCTGCAGGCCTGTCACTACAGATATCTCCCATTCGTGTGCCGCGAGCTGGACGTGGGGC
CTGATGAGGTTGAATATATTGCGCCGTGCTCGCCGCTGCAACAGGGCATCATCTTCAAAGCTCTCAGTAACGAGA
GCTCCGACCCTTACTTTTCCTCTTTCGAGCTGAGACTGGATAGAGGCGCCTCGGTTGACAGAGTCCGCGACGCCT
GGAGTCGGACTGTTGATGCTCACGCCATACTTCGATCTGTTTTTGTCAACACCCCTGATGGGCATATTCAGGTCG
CAATGCGTCAGACAAAGGGTCAATGGCAAGACGTGAAATTTGAATCTCAAGACGAACTCTTTCTCACCATGGAAA
CGAAAAGGCGAGATTGGGTTGCGAAAAACAGGCATCACTTTGGCCGCCCCATCGAGCTCATTCACGCGCAGGGGC
CGGACTCTCAGAGGCTCTTCCTCCACATCTTCCATGCGCTCTACGACGGCAGCAGCTTGCGACTCATCAGCCACT
ATGCCAAGGCCCTGTACCGCGACGAGCAACCGCCGTCAAGCCCCCCATTTATCGAGGCCTTGAGCCACGGGCCGC
TCTCAAGACACGATCAGTGCCGACAGTTTTGGACGGAGCACATGCGTGGCTGGACACCGTCACCAGTGCCGACGC
TCGCAGCATCGTCAGACGAACTCAGAGGCGTGACAGTCAGTCGCAACGTTCCGCTGGCCCTACTCGAGGGGCTGC
GACGTCAACAAAACGTCACGATGCAGTCTGTCGTGCTCGCCCTGTGGACTTCGGTCCTCCAGAGATGTCTGACCA
GCAGCGTCACAGTTGGCGTCATTCTTTCAGGCAGGTCTATTGACCTTGCTGGGGTCGAGCGGACAATCGGCCCTC
TGTTCAACACCGTGCCCTTCTTCGTCGACGCCCTGCGAGAGCGCACTTGGTCGTCGTTGATCCGCGAGGCCCATG
GCTTCAGCACTTCGGTAATGCCTTTCCAACATGTGCCCCTGAAGGACATCCAGTCATGGTGCTCTGGAGGCCGTC
CGCTTTTCGACAATCTCTTTGTGTTCCAGCTTGAACAGCCTGAATGGTGCGACGAAGCTGCGCTTTGGGAGGTCG
AAGACGGTCCGGATCGCCCCGATTACCCCCTGGCGCTCGAAGCGACGCGAACATTAGGGGGGAACTTACGGCTAT
GCCTTGTGTCGCAAAGCCGGTATGCTGATGCAGTCATGCTGGAGGGCATGCTGGACCAATTCGAACAGGTGATGG
CGACAGCCGAGGCGGAGGCAACGGGGAGTCCTTGGCAAGGCGCTACAGAGCCCAATCAGGGGGTGTTAGTCGGGA
ACTCTGGAGAGGAAGAGGCGGAGGTCATGTTCGACTGGACGGAGGAAGCTGTTGTGGTGAGGAATGAGTTGGCGC
TACTTGCCCGCATACCCCCTGAACAAGTCGGCGCAACAACTATGCTGCTGGAGCTGGGCCTTGACAGCATTGATG
CGATGAAGCTCTCAACAAGGCTGAAGCAGCGTGGAATCAACGTATCTGCGTCAAACATACTGCGAAGCCAGACGA
TAGCCCGTCTCGTTGGTCAGCTGGAGATGAGCGGCGTTGCGCTTCCATCCAACTCTGAGTCTTCGAAACTCCTCG
AAGAGATAAGATCTAGGCTCTGGATCGAGGTAGAGAATGGTGTGACAGACGCGAAAATGGTTGAGTCGGTCTTGC
CTCCGACTCCTCTCCAGGAAGCCATGGTTTCGGGCATGGTTCAGTCAGGCTTTCAGTGGTACTTCAACCACGATA
TCCTCGAGGTGGCCGACTGGGTCGACATGGAGAGGCTTGGTGCCGCGTGGAGGCAGCTGATCGAGGCATCGCCAT
GCTTGAGAAGCGGCTTCATCGAAGTTGGCGACTCGAATCTGGACGTGTCGTACTGCCAAGTCACCTTCAAGAGCA
GAACTTGTTGCGTCAAGACGCGGGCGCTGGCGGACAAGTCTGAGATGGGACAGGTGATGCTGGACGCGACGCGGC
TGGCTGCTCAAAGCAAGGGACTGCAAGACTTGGTGCAGATTGCGCTGGTGACGGTTGGCGAGCGACGTCTCGTTG
TCGTTTCCATGGCTCATGCTCTCTACGACGGTTGGTCGCTCGGGCTCATGTATCGGGATCTGGAAGAGCTGTACT
GGGGGCGGGAGAGGAAGACACAACAAACATCCACCGATGCTTTTGTTGGGCGCGTTCTGGCCTGCAGGACGGAAG
AGGCCCGCGGTTTCTGGACTGGTCATCTCGCGGGCCTTCGGCCGACTTTGTTGACAGGAAGGGCGAAGACGACAA
CGAAAACAGGAGACTGGCCGTTGCGCAAAGAAGCTCCGTCCGGCTGCAGTCTCTCTCAACTAACAAGCTTCTGCA
AGAGGCAGGCAATCAGTCTACAGGTGCTCTGCGTCGCCACATGGGCTGTCGTCGTGGCGGAGCGAACCAGGGGCC
TCGATGTCGTCTTCGGACTCGTGCTGTCTGGCAGAGACGGAGAGGGGACGGAGGAGCTGATGTTGCCGACCATGA
GCACAGTGGCCTTGCGCTGCGTCCTTCACGGCTCCGTCTCCAGCTTCCTCAAATATGTGGAGGAGACGGTGACGG
ATGTCAGGGGCTATCAGCATTACCCCCTGCGCAGGGTTCAAGCTGCGGAGGCCTTTAACTCGCTTTTCCTATTCC
AAAAGACGCCCAGACAGAATGAGGCGTCGACCCGGCTGTTTCGGTCCATCGACGGCCAGTCAGCTGTCGAATATC
CGGTCTGTGTCGAGGCCGAGCCCGTCGACGATGGACTTGTTTGGCGTGTCGCCTGCCACCGACAACTCTTCTCCA
GCCAAGACACCCAGCTGCTACTCAGTAGGTTGGATCAGGTGCTACAGTACATGTTTGACCACGAGGCCATTGCTG
TCCTCTCCTTCGAGGATGAGGGCGTGTCGATTTGCGGGCTGCCGGTGCTGGAGGTCGAGGAAGGGCGTGTCCTCG
ACTGCCGGCCCGACGTGACCGACGACCAGCCAAGCGAGCAGGAAACCTGGGGAGACACGGCTACTGCAATTCGCC
ATGTCTTGAGCCAGGTTTCGGACATGCCAGTCGAGTCGATAACGCTTCGATCCAGCCTGTACCAGCTCGGCCTCG
ACTCCATCAGTGCCGTCAAGGTGTCGATGCTACTCCGCAAGAGAGGAATCGAACTAAAACCGAGGCAGCTCGTCA
AGCTGTCGAGCTTGAGGGAAATGGCAGACAACGTGACGCTCGCAGGACAAGACACTAAGAAGCAGAAGTCCCATC
CGGGAGTGACGTGGAAGCCCCCTAGGTCCATGGACGTGGACGAGCTGCTCCGAGAGTGTAACGTGCCGAGAGACT
GCGTCGAGGCGGTGCTGCCAGCGACGCCGATGCAGGCGTACATGCTGACGGCATGGGAGAAGCCAGGCGGCGCCG
TCTTCTTCCCAGAGTTTCACTACCGTATGGACGGCACTGATGACGTGTTGAGGGCCCAAGAGGCATGGAAGATGC
TCAGCGACCAGACGGCCGTGCTGCGAACACGCTTCTTGGCCACCGGCTTTGATGAGGTACCGTGGATCCAGGCGG
TGATGCACAAGGAGGCCATCCGATCCGGCCGCATATCACAGCCCCTGGTCCGTCTCGACATCAACAAGGCCGACT
CGGGCAAGGGACTGGAGCTGCGACTCAAGATACACCATGCCCTGTATGATGAACTCAGCCTGGCAGCCCTGACTT
CGCAGCTGTGCGAGCTTGTGAACAGCACGGCAGCCCCTGAGAGCGACGACGACGACGACGACGACGACGACGACG
ACGACGGTTTCTCACGGTGGGCGCTCTACTGCAATGCTCTGCCGGACGGCCGGGCCAGACGGCGAGAGTTCTGGA
CCGAGTATTTGAGGGGAGGCACCGCCGTCGACATTGAAGCGTCTTCGGCGACCGACACGGCCGAGAGAGCGTCCT
ACCTCGACAAGTCAGCCGTGAACGACGTGACGGATCTACGGGCAACGGCCTCACAGCACAGCATAAGCCTGCAAG
CACTCGTCTTAGCCGCGCTGGCGAAGAGCCTGGCCGGACGAGACTCGGAGCGTGCAATCATCCTGGGCATCTACC
TCGCCAACCGAGCCGGCGGCGAACGAGACTCGCCACCTGCGACGTGTCCGACGCTCAACCTAGTGCCGGTCAAGG
TGCAGCCAAGTCCGGGCCTCCGTCTTGTCGACATGGCGAGGGCGATTCAAGCCGATGTCGTCAGCATAGGCGACG
ACGGACGAGCCCAAGTCGGGCTCTGGGAGATTCTGGCCTGGACGGGCGTCCGGATCGGCTGCTTCGTCAACTTTC
TCGTCGGCGGCGCCAAGGTGGACCGCGTCGGGGATGTCGTCACTCTCCGTTCCGTACAAGGAGACGTCATGCCCA
TCATGGTGATGGGAGAAGCGTCGCCGCGCGGGCCCAGGAGGAACGTGGTTAGCGACGCGGTCGAGGTGAGATTTT
CTTCTCTTCTTCTTCTTCTCCTTCTTCTCCTTTTTCTTCTTCTTCTCCTTCTTTCGACCGTTTCAAATGCAGAGC
CTCGCTAAACGACGAAAAAAATAAAAATAAAAAACAATAGCCTTCGGTCGACATCGAGGCCTCGGTCAGCGGGGA
CAAGGCTCTCGCCGTCGGAGTCTTTGGCCCGAGGGGGCGCGTGACGGACGAGTGGGCCGCCAAGCTGGTTGCCGA
TACGGTTGCGTTCCTGGCCGAGGCGGGCGCGGGCGGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail