Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1450
Gene name
Locationscaffold_15:69648..72749
Strand+
Gene length (bp)3101
Transcript length (bp)2763
Coding sequence length (bp)2760
Protein length (aa) 920

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03707 MHYT Bacterial signalling protein N terminal repeat 8.0E-10 68 126
PF03707 MHYT Bacterial signalling protein N terminal repeat 5.9E-05 137 191

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O34311|YKOW_BACSU Signaling protein YkoW OS=Bacillus subtilis (strain 168) GN=ykoW PE=3 SV=2 17 219 1.0E-12
sp|Q9I310|Y1727_PSEAE Uncharacterized signaling protein PA1727 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA1727 PE=3 SV=1 20 247 3.0E-09

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.5

Transmembrane Domains

Domain # Start End Length
1 22 44 22
2 56 78 22
3 93 115 22
4 124 146 22
5 161 183 22
6 196 218 22
7 238 260 22
8 302 324 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1450
MSTTTRQLLDRYSDRLVPVSFHAGFVCLSYAISLIGTCSTLELLRRRTSHKGLSNLLLLIGAAISMGGIAIWSMH
FIGNRAIYILDGREDLQIAYSTGMTILSLIVPIFVLVVAFLATSVNGRIRWWRICIAGFSSGGAICGMHYLADAS
ISNYQASYIVGYVAGATVISVVASTAALSLFFVFETAWKVVWWKRLGCAMVLAGAVSGMHWCAAVGTSYTLLRSR
NLQNGMSRKETLIMVICLSIAAGVTMTASSIYSGWVRRDYASKSQQVVLAAAVFDDKGRIMVNQEGFLPTEVVTD
TFIAKVGSTSIILSLFTVCIMTCIYSPKLSPWQTHNEVFDTSHPLFQWMYRASRNWNSIAALTDQMETHIGQVSQ
DKYNHRIGLKLIAEDGLLVPYYDQMICELFSLAALALARKTKEDLCHIGTLWDEIFATGNLPTSPAFSSIVSSSV
LSTRQGGASRDKTTLLGDLAEKGLVPVPPQYGRGCLMFLVRHVNARKDMDKLEAAGFRFAEMHHVMATISSSMQI
KDAEFAERLRIMSAASNHGSPLDAGVYLGIFAIRARLDRCGFDVLVRKGARNLLPTACLPFRRVEPWHQHLLCRL
HGQTPAAMIKSLYGFGNQGSPEANFGSIMRQAIQRLGDVIGDESFENATLMSQVVQVPCSAQDGSRLSTCSLVAF
RVVLPIHATAPASGCEFVPLSFFQTQQMVYEGSAHHVEFSHKVHRELSSFLHVTPAKPRNKGRRRPLPRRVMACI
RRSQSSRRIDDEVVLQSSIQSHHRLSTLAVNNSWPRAPSDELSFNDWLKRQSTSFPSPVANLGVMPPDDFSQHRE
KLQLGGIMISQQITVDVEKMPHVSTTEISSGSQAGDNAKSSTEMRSCHDETENVVEAKFFSTAFGEHSSKAALQQ
EGSGFVNKLLVLCMDNKANV
Coding >Ophio5|1450
ATGTCGACGACCACTCGGCAATTGCTTGATCGATATTCGGATCGGCTGGTGCCCGTCTCCTTTCACGCCGGCTTC
GTATGTTTGAGCTACGCCATCAGTCTTATTGGTACATGCTCGACCTTGGAGCTCCTGCGCAGGCGGACTTCTCAC
AAGGGTCTTTCGAACCTACTATTGTTGATTGGTGCAGCAATATCCATGGGCGGCATCGCCATATGGTCCATGCAC
TTCATCGGAAACAGAGCAATCTACATCCTCGATGGCCGTGAAGATTTGCAAATCGCCTATTCCACTGGCATGACG
ATTCTATCCTTGATAGTCCCCATCTTCGTCCTCGTCGTCGCATTCCTCGCCACGAGCGTCAACGGTAGAATACGC
TGGTGGCGAATATGTATTGCCGGTTTCTCCTCGGGCGGCGCCATCTGCGGCATGCATTATCTGGCTGATGCGTCC
ATAAGCAACTACCAAGCCTCCTATATTGTCGGCTACGTGGCTGGAGCCACTGTGATATCCGTTGTAGCCAGCACA
GCCGCACTGTCTCTCTTCTTCGTCTTTGAGACGGCGTGGAAGGTCGTCTGGTGGAAGAGGCTAGGTTGCGCCATG
GTGTTGGCCGGGGCCGTGTCGGGCATGCACTGGTGCGCTGCCGTTGGCACGAGCTACACCTTGCTCCGGTCTCGA
AATCTGCAGAATGGCATGTCTCGGAAGGAAACGCTCATCATGGTTATTTGCTTGTCCATTGCCGCCGGTGTTACT
ATGACGGCGAGTTCCATCTACTCTGGGTGGGTCAGGAGAGACTATGCCAGCAAGTCGCAGCAGGTTGTATTGGCC
GCAGCCGTGTTTGACGACAAGGGAAGAATCATGGTAAACCAGGAAGGCTTTCTTCCGACTGAGGTGGTTACCGAC
ACATTTATTGCCAAGGTCGGTTCTACATCAATCATCTTATCTCTTTTCACTGTCTGTATTATGACTTGCATCTAC
TCACCAAAACTTTCACCCTGGCAGACGCATAATGAGGTCTTTGATACCAGTCATCCACTCTTCCAGTGGATGTAC
CGAGCGTCTCGAAACTGGAACAGCATCGCAGCTCTTACCGACCAAATGGAAACTCACATTGGTCAAGTCTCGCAG
GATAAATACAACCATAGAATCGGACTCAAGTTGATAGCAGAGGACGGTCTGTTGGTGCCGTATTACGATCAGATG
ATCTGCGAGCTGTTTAGCCTCGCAGCCCTTGCCCTCGCACGAAAGACGAAGGAGGATCTCTGCCATATCGGGACA
CTTTGGGACGAGATATTCGCTACTGGCAATCTCCCGACCAGTCCGGCTTTTTCTTCTATAGTTTCCAGTTCAGTG
CTTAGTACCAGGCAAGGCGGAGCTTCGAGGGACAAGACGACGCTTCTTGGAGATTTGGCGGAAAAGGGGCTTGTC
CCCGTACCTCCCCAGTACGGACGCGGTTGTCTCATGTTCCTGGTCCGCCACGTCAACGCAAGAAAAGACATGGAC
AAGCTCGAGGCTGCCGGGTTTCGCTTCGCAGAGATGCACCACGTCATGGCTACCATATCCTCCAGCATGCAGATT
AAAGATGCCGAATTTGCCGAGCGGCTACGAATCATGTCCGCCGCCTCGAATCACGGTTCTCCGTTAGATGCAGGC
GTCTATCTTGGCATCTTTGCTATACGTGCACGGCTCGATCGCTGCGGTTTCGACGTGCTCGTTCGCAAGGGGGCC
AGAAACCTTTTGCCCACTGCCTGTCTCCCGTTCCGGCGCGTCGAGCCATGGCATCAACATCTTTTATGCCGTCTT
CACGGCCAAACACCGGCTGCCATGATCAAGTCGCTCTACGGCTTCGGCAACCAAGGTTCCCCTGAAGCCAATTTC
GGATCCATCATGCGACAGGCCATCCAAAGACTTGGTGACGTGATAGGCGACGAATCCTTCGAGAACGCGACTCTC
ATGTCTCAGGTCGTACAGGTGCCTTGCTCCGCTCAAGACGGCTCGCGGCTATCGACATGTTCTCTTGTCGCTTTT
CGAGTAGTTCTACCGATTCACGCCACAGCTCCCGCTTCCGGGTGCGAATTCGTTCCGCTGAGTTTCTTTCAGACT
CAGCAGATGGTGTACGAGGGTTCTGCCCATCACGTCGAGTTCTCGCACAAGGTACACCGCGAGCTATCTTCTTTC
CTTCACGTTACTCCCGCAAAGCCCCGCAACAAAGGTCGGCGAAGACCGTTGCCGCGTCGGGTGATGGCGTGCATC
AGGAGATCGCAATCGTCCCGCCGTATCGACGACGAGGTTGTCCTCCAGTCATCCATCCAGAGTCATCATCGGCTG
TCGACGTTGGCTGTCAATAACAGCTGGCCTCGTGCCCCCAGTGACGAGCTGAGCTTCAACGATTGGCTGAAGAGA
CAATCCACCAGCTTCCCATCACCAGTTGCCAACCTCGGCGTCATGCCCCCGGACGACTTTTCTCAGCATCGGGAG
AAGCTGCAACTGGGCGGAATCATGATTTCTCAGCAGATAACGGTGGACGTCGAGAAGATGCCTCATGTGTCGACG
ACGGAGATATCGTCAGGCAGCCAAGCCGGAGACAACGCCAAGTCCAGCACCGAGATGCGATCCTGCCATGATGAG
ACGGAAAATGTAGTCGAGGCAAAGTTTTTCTCAACTGCCTTTGGCGAGCATAGCAGCAAAGCGGCGTTGCAGCAA
GAAGGATCAGGCTTCGTGAACAAGCTGCTCGTATTATGCATGGACAATAAAGCCAATGTA
Transcript >Ophio5|1450
ATGTCGACGACCACTCGGCAATTGCTTGATCGATATTCGGATCGGCTGGTGCCCGTCTCCTTTCACGCCGGCTTC
GTATGTTTGAGCTACGCCATCAGTCTTATTGGTACATGCTCGACCTTGGAGCTCCTGCGCAGGCGGACTTCTCAC
AAGGGTCTTTCGAACCTACTATTGTTGATTGGTGCAGCAATATCCATGGGCGGCATCGCCATATGGTCCATGCAC
TTCATCGGAAACAGAGCAATCTACATCCTCGATGGCCGTGAAGATTTGCAAATCGCCTATTCCACTGGCATGACG
ATTCTATCCTTGATAGTCCCCATCTTCGTCCTCGTCGTCGCATTCCTCGCCACGAGCGTCAACGGTAGAATACGC
TGGTGGCGAATATGTATTGCCGGTTTCTCCTCGGGCGGCGCCATCTGCGGCATGCATTATCTGGCTGATGCGTCC
ATAAGCAACTACCAAGCCTCCTATATTGTCGGCTACGTGGCTGGAGCCACTGTGATATCCGTTGTAGCCAGCACA
GCCGCACTGTCTCTCTTCTTCGTCTTTGAGACGGCGTGGAAGGTCGTCTGGTGGAAGAGGCTAGGTTGCGCCATG
GTGTTGGCCGGGGCCGTGTCGGGCATGCACTGGTGCGCTGCCGTTGGCACGAGCTACACCTTGCTCCGGTCTCGA
AATCTGCAGAATGGCATGTCTCGGAAGGAAACGCTCATCATGGTTATTTGCTTGTCCATTGCCGCCGGTGTTACT
ATGACGGCGAGTTCCATCTACTCTGGGTGGGTCAGGAGAGACTATGCCAGCAAGTCGCAGCAGGTTGTATTGGCC
GCAGCCGTGTTTGACGACAAGGGAAGAATCATGGTAAACCAGGAAGGCTTTCTTCCGACTGAGGTGGTTACCGAC
ACATTTATTGCCAAGGTCGGTTCTACATCAATCATCTTATCTCTTTTCACTGTCTGTATTATGACTTGCATCTAC
TCACCAAAACTTTCACCCTGGCAGACGCATAATGAGGTCTTTGATACCAGTCATCCACTCTTCCAGTGGATGTAC
CGAGCGTCTCGAAACTGGAACAGCATCGCAGCTCTTACCGACCAAATGGAAACTCACATTGGTCAAGTCTCGCAG
GATAAATACAACCATAGAATCGGACTCAAGTTGATAGCAGAGGACGGTCTGTTGGTGCCGTATTACGATCAGATG
ATCTGCGAGCTGTTTAGCCTCGCAGCCCTTGCCCTCGCACGAAAGACGAAGGAGGATCTCTGCCATATCGGGACA
CTTTGGGACGAGATATTCGCTACTGGCAATCTCCCGACCAGTCCGGCTTTTTCTTCTATAGTTTCCAGTTCAGTG
CTTAGTACCAGGCAAGGCGGAGCTTCGAGGGACAAGACGACGCTTCTTGGAGATTTGGCGGAAAAGGGGCTTGTC
CCCGTACCTCCCCAGTACGGACGCGGTTGTCTCATGTTCCTGGTCCGCCACGTCAACGCAAGAAAAGACATGGAC
AAGCTCGAGGCTGCCGGGTTTCGCTTCGCAGAGATGCACCACGTCATGGCTACCATATCCTCCAGCATGCAGATT
AAAGATGCCGAATTTGCCGAGCGGCTACGAATCATGTCCGCCGCCTCGAATCACGGTTCTCCGTTAGATGCAGGC
GTCTATCTTGGCATCTTTGCTATACGTGCACGGCTCGATCGCTGCGGTTTCGACGTGCTCGTTCGCAAGGGGGCC
AGAAACCTTTTGCCCACTGCCTGTCTCCCGTTCCGGCGCGTCGAGCCATGGCATCAACATCTTTTATGCCGTCTT
CACGGCCAAACACCGGCTGCCATGATCAAGTCGCTCTACGGCTTCGGCAACCAAGGTTCCCCTGAAGCCAATTTC
GGATCCATCATGCGACAGGCCATCCAAAGACTTGGTGACGTGATAGGCGACGAATCCTTCGAGAACGCGACTCTC
ATGTCTCAGGTCGTACAGGTGCCTTGCTCCGCTCAAGACGGCTCGCGGCTATCGACATGTTCTCTTGTCGCTTTT
CGAGTAGTTCTACCGATTCACGCCACAGCTCCCGCTTCCGGGTGCGAATTCGTTCCGCTGAGTTTCTTTCAGACT
CAGCAGATGGTGTACGAGGGTTCTGCCCATCACGTCGAGTTCTCGCACAAGGTACACCGCGAGCTATCTTCTTTC
CTTCACGTTACTCCCGCAAAGCCCCGCAACAAAGGTCGGCGAAGACCGTTGCCGCGTCGGGTGATGGCGTGCATC
AGGAGATCGCAATCGTCCCGCCGTATCGACGACGAGGTTGTCCTCCAGTCATCCATCCAGAGTCATCATCGGCTG
TCGACGTTGGCTGTCAATAACAGCTGGCCTCGTGCCCCCAGTGACGAGCTGAGCTTCAACGATTGGCTGAAGAGA
CAATCCACCAGCTTCCCATCACCAGTTGCCAACCTCGGCGTCATGCCCCCGGACGACTTTTCTCAGCATCGGGAG
AAGCTGCAACTGGGCGGAATCATGATTTCTCAGCAGATAACGGTGGACGTCGAGAAGATGCCTCATGTGTCGACG
ACGGAGATATCGTCAGGCAGCCAAGCCGGAGACAACGCCAAGTCCAGCACCGAGATGCGATCCTGCCATGATGAG
ACGGAAAATGTAGTCGAGGCAAAGTTTTTCTCAACTGCCTTTGGCGAGCATAGCAGCAAAGCGGCGTTGCAGCAA
GAAGGATCAGGCTTCGTGAACAAGCTGCTCGTATTATGCATGGACAATAAAGCCAATGTATAG
Gene >Ophio5|1450
ATGTCGACGACCACTCGGCAATTGCTTGATCGATATTCGGATCGGCTGGTGCCCGTCTCCTTTCACGCCGGCTTC
GTATGTTTGAGCTACGCCATCAGTCTTATTGGTACATGCTCGACCTTGGAGCTCCTGCGCAGGCGGACTTCTCAC
AAGGGTCTTTCGAACCTGTACGTCAGTTCGTGGAGGATGCCGGGAAAATGTGCGTGCGGGCTAATACATTTGTTT
CACAGACTATTGTTGATTGGTGCAGCAATATCCATGGGCGGCATCGCCATATGGTCCATGGTAGGTAGGCCCTTG
ACTCCTTGACTCCCCGTGTCTCACACCAAGCAAGCCCTCCTCTGTCTCTTCTCATCATGTTGCCTTGATCCATGT
CAATCATTAATCAACAATCTACTTGTTTCACTCTAACGGAAGCTTTCCCCCAGCACTTCATCGGAAACAGAGCAA
TCTACATCCTCGATGGCCGTGAAGATTTGCAAATCGCCTATTCCACTGGCATGACGATTCTATCCTTGATAGTCC
CCATCTTCGTCCTCGTCGTCGCATTCCTCGCCACGAGCGTCAACGGTAGAATACGCTGGTGGCGAATATGTATTG
CCGGTTTCTCCTCGGGCGGCGCCATCTGCGGCATGCATTATCTGGCTGATGCGTCCATAAGCAACTACCAAGCCT
CCTATATTGTCGGCTACGTGGCTGGAGCCACTGTGATATCCGTTGTAGCCAGCACAGCCGCACTGTCTCTCTTCT
TCGTCTTTGAGACGGCGTGGAAGGTCGTCTGGTGGAAGAGGCTAGGTTGCGCCATGGTGTTGGCCGGGGCCGTGT
CGGGCATGCACTGGTGCGCTGCCGTTGGCACGAGCTACACCTTGCTCCGGTCTCGAAATCTGCAGAATGGCATGT
CTCGGAAGGAAACGCTCATCATGGTTATTTGCTTGGTAAACCTGTCCCCGTCAGAGTGTGGCTTGACTACAGTCT
GATGACGAGACATACCTAGTCCATTGCCGCCGGTGTTACTATGACGGCGAGTTCCATCTACTCTGGGTGGGTCAG
GAGAGACTATGCCAGCAAGTCGCAGCAGGTTGTATTGGCCGCAGCCGTGTTTGACGACAAGGGAAGAATCATGGT
AAACCAGGAAGGCTTTCTTCCGACTGAGGTGGTTACCGACACATTTATTGCCAAGGTCGGTTCTACATCAATCAT
CTTATCTCTTTTCACTGTCTGTATTATGACTTGCATCTACTCACCAAAACTTTCACCCTGGCAGACGCATAATGA
GGTCTTTGATACCAGTCATCCACTCTTCCAGTGGATGTACCGAGCGTCTCGAAACTGGAACAGCATCGCAGCTCT
TACCGACCAAATGGAAACTCACATTGGTCAAGTCTCGCAGGATAAATACAACCATAGAATCGGACTCAAGTTGAT
AGCAGAGGACGGTCTGTTGGTGCCGTATTACGATCAGATGATCTGCGAGCTGTTTAGCCTCGCAGCCCTTGCCCT
CGCACGAAAGACGAAGGAGGATCTCTGCCATATCGGGACACTTTGGGACGAGATATTCGCTACTGGCAATCTCCC
GACCAGTCCGGCTTTTTCTTCTATAGTTTCCAGTTCAGTGCTTAGTACCAGGCAAGGCGGAGCTTCGAGGGACAA
GACGACGCTTCTTGGAGATTTGGCGGAAAAGGGGCTTGTCCCCGTACCTCCCCAGTACGGACGCGGTTGTCTCAT
GTTCCTGGTCCGCCACGTCAACGCAAGAAAAGACATGGACAAGCTCGAGGCTGCCGGGTTTCGCTTCGCAGAGAT
GCACCACGTCATGGCTACCATATCCTCCAGCATGCAGATTAAAGATGCCGAATTTGCCGAGCGGCTACGAATCAT
GTCCGCCGCCTCGAATCACGGTTCTCCGTTAGATGCAGGCGTCTATCTTGGCATCTTTGCTATACGTGCACGGCT
CGATCGCTGCGGTTTCGACGTGCTCGTTCGCAAGGGGGCCAGAAACCTTTTGCCCACTGCCTGTCTCCCGTTCCG
GCGCGTCGAGCCATGGCATCAACATCTTTTATGCCGTCTTCACGGCCAAACACCGGCTGCCATGATCAAGTCGCT
CTACGGCTTCGGCAACCAAGGTTCCCCTGAAGCCAATTTCGGATCCATCATGCGACAGGCCATCCAAAGACTTGG
TGACGTGATAGGCGACGAATCCTTCGAGAACGCGACTCTCATGTCTCAGGTCGTACAGGTGCCTTGCTCCGCTCA
AGACGGCTCGCGGCTATCGACATGTTCTCTTGTCGCTTTTCGAGTAGTTCTACCGATTCACGCCACAGCTCCCGC
TTCCGGGTGCGAATTCGTTCCGCTGAGTTTCTTTCAGACTCAGCAGATGGTGTACGAGGGTTCTGCCCATCACGT
CGAGTTCTCGCACAAGGTACACCGCGAGCTATCTTCTTTCCTTCACGTTACTCCCGCAAAGCCCCGCAACAAAGG
TCGGCGAAGACCGTTGCCGCGTCGGGTGATGGCGTGCATCAGGAGATCGCAATCGTCCCGCCGTATCGACGACGA
GGTTGTCCTCCAGTCATCCATCCAGAGTCATCATCGGCTGTCGACGTTGGCTGTCAATAACAGCTGGCCTCGTGC
CCCCAGTGACGAGCTGAGCTTCAACGATTGGCTGAAGAGACAATCCACCAGCTTCCCATCACCAGTTGCCAACCT
CGGCGTCATGCCCCCGGACGACTTTTCTCAGCATCGGGAGAAGCTGCAACTGGGCGGAATCATGATTTCTCAGCA
GATAACGGTGGACGTCGAGAAGGTATGCATTTTTTTTTGTCATCTTGGGTGCTGCCGCGTTTCGGGCTTGACTGC
TAACTACCGCCCCTCTACAGATGCCTCATGTGTCGACGACGGAGATATCGTCAGGCAGCCAAGCCGGAGACAACG
CCAAGTCCAGCACCGAGATGCGATCCTGCCATGATGAGACGGAAAATGTAGTCGAGGCAAAGTTTTTCTCAACTG
CCTTTGGCGAGCATAGCAGCAAAGCGGCGTTGCAGCAAGAAGGATCAGGCTTCGTGAACAAGCTGCTCGTATTAT
GCATGGACAATAAAGCCAATGTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail