Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1446
Gene name
Locationscaffold_15:52846..54958
Strand+
Gene length (bp)2112
Transcript length (bp)2112
Coding sequence length (bp)2109
Protein length (aa) 703

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.8E-22 331 576
PF00550 PP-binding Phosphopantetheine attachment site 4.3E-10 78 140
PF00550 PP-binding Phosphopantetheine attachment site 3.8E-10 189 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 34 253 2.0E-29
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 31 253 1.0E-20
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 147 255 1.0E-15
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 78 181 2.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 201 633 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 34 253 2.0E-29
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 31 253 1.0E-20
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 147 255 1.0E-15
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 78 181 2.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 201 633 1.0E-14
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 7 142 7.0E-14
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 136 253 1.0E-12
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 175 699 2.0E-12
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 329 579 3.0E-12
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 209 579 1.0E-10
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 192 649 5.0E-10
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 329 588 2.0E-09
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 202 583 3.0E-09
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 274 630 7.0E-09
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 312 632 1.0E-07
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 312 579 1.0E-07
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 330 632 2.0E-07
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 325 575 6.0E-07
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 325 579 6.0E-07
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 175 7.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 330 632 7.0E-07
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 319 583 2.0E-06
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 189 690 2.0E-06
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 330 657 3.0E-06
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 319 645 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1446
MDLDFNALFYEYPTVGDLKGFLLGGAASPNSSGQSTPMSSSTGPSTPRSVATGASTPGPEMFSKLDPSPPKVDFR
RALQIISEESGVAVEDLTDETNFADSGVDSLLSLVIVSRYRDELELEIQHESLFLECPTVADLKKLLLGVTSTAA
PSRPLPPPVAEPLSTPTPSPKPNTSSFVPESKVDFRRALEIISEESGVATEDLTDNTNFADSGIDSLLSLVIVSR
YRDELELDIQHESLFLECPTVADLKKLLLGDSTTSQPVTEQASSQEEVVDDKYSVTRVHIDQAELDARKRAVDVL
VHKHTAGFTAPPAAASGLLGSPNDDDKVVLVTGASGSLGGHLVYHIAQLPDVKTVVCLNRENKEEPNVRQQKAMR
GKGIRFPESLKHKLVVLQTDSAKPMFGLSSSVYQGLVNSVTHLIHNAWPMSAKRPLSGFESQFQVMRNLIDFGCH
VSSRRPSSFQFSFQMVSSIGVVGHYGLANATDTTRIMVPEKSVDIDSVLPNGYGDAKWGCERMLDETLRKHPTRF
RTMVVRLGQIAGSKTSGYWNPMEHFGFLIKSSQTLNALPDVDGTVFWTPVNDIAATLSDLVLSDRKPHAVYHIEN
PVGQSWRETNAILADALKIPNLIPFSEWVERVRAAPQRNNPASTLLDFLDGNYLRMSCGGLVLDVKNTLEHSKTL
AAVGPVSEEVVRKYIHIWKEIGFLNSSS
Coding >Ophio5|1446
ATGGATCTCGACTTCAACGCCCTCTTCTACGAGTACCCGACTGTCGGTGATCTCAAGGGCTTCCTCCTGGGCGGC
GCCGCCAGCCCCAACTCGAGCGGACAGTCGACGCCCATGTCGAGCAGCACCGGACCTTCGACTCCTCGCTCTGTT
GCTACCGGGGCGAGCACGCCGGGTCCGGAGATGTTCTCCAAGCTAGACCCTTCCCCCCCCAAGGTCGACTTCCGA
CGCGCCCTCCAGATCATCTCGGAGGAGAGTGGCGTCGCGGTTGAGGACCTCACGGATGAGACCAACTTTGCCGAT
TCGGGAGTCGACTCTCTCTTGTCGCTTGTCATCGTCAGCCGCTATCGTGATGAGCTCGAGCTCGAAATCCAGCAC
GAGTCTCTTTTCCTCGAGTGTCCGACGGTCGCTGACCTGAAGAAGTTGCTGCTGGGAGTCACCTCGACGGCGGCG
CCCTCTCGCCCCCTGCCTCCTCCCGTGGCAGAGCCCCTGTCGACGCCGACGCCTAGCCCCAAGCCCAACACGTCG
AGTTTCGTGCCAGAAAGCAAAGTCGACTTTCGACGCGCCCTCGAGATTATTTCCGAGGAGAGCGGAGTGGCGACG
GAGGATCTGACTGACAACACCAACTTTGCCGACTCCGGTATCGACTCCCTGCTGTCACTCGTCATCGTCAGTCGC
TATCGAGATGAGCTCGAGCTCGATATCCAGCACGAGTCGCTCTTCCTTGAATGCCCTACCGTGGCGGATCTGAAG
AAGCTCCTACTCGGGGATTCGACCACGTCTCAGCCTGTGACGGAGCAGGCCTCAAGCCAGGAGGAGGTGGTCGAC
GACAAGTACTCGGTCACGCGAGTTCACATCGACCAAGCTGAACTCGACGCTCGCAAGAGGGCCGTCGACGTCCTC
GTCCACAAACACACGGCTGGCTTCACGGCTCCCCCCGCTGCTGCTTCGGGCCTGCTCGGCTCACCAAACGATGAC
GACAAGGTCGTCCTCGTCACTGGTGCTTCGGGAAGTCTGGGCGGTCATCTTGTCTATCACATTGCCCAGCTCCCG
GACGTCAAGACGGTGGTGTGTCTGAACCGCGAGAACAAGGAGGAGCCCAACGTTCGGCAGCAAAAGGCGATGAGA
GGAAAGGGCATCCGCTTCCCCGAGTCTCTCAAGCACAAGCTGGTCGTTCTGCAGACGGACAGCGCCAAGCCCATG
TTCGGCCTGTCGTCCAGCGTCTACCAAGGTCTCGTCAACTCGGTCACCCATCTCATCCATAACGCCTGGCCGATG
AGTGCCAAGCGCCCGCTGTCCGGCTTCGAGTCGCAGTTCCAGGTGATGCGTAACCTGATTGACTTTGGCTGCCAC
GTCTCGAGCCGTCGTCCGTCTTCCTTCCAGTTCAGCTTCCAGATGGTGTCGTCCATCGGAGTCGTCGGTCATTAT
GGTCTCGCCAACGCCACAGACACGACGAGGATCATGGTTCCCGAGAAGAGCGTCGACATCGACTCCGTCCTCCCC
AACGGCTACGGCGATGCCAAATGGGGATGCGAGAGGATGCTGGACGAGACGCTACGCAAGCATCCCACCCGCTTC
CGCACCATGGTCGTCCGCCTCGGACAGATTGCCGGCTCCAAGACGAGCGGATACTGGAACCCGATGGAGCATTTC
GGCTTCCTCATCAAGTCTTCTCAGACGCTCAACGCCCTGCCCGATGTCGACGGCACCGTCTTTTGGACCCCCGTC
AACGACATCGCCGCCACCCTCTCGGATCTGGTACTGTCTGACCGAAAACCGCACGCTGTCTATCACATCGAGAAT
CCCGTCGGCCAGTCTTGGCGCGAGACCAACGCCATCTTGGCCGACGCCCTTAAAATTCCCAACCTCATCCCCTTT
AGCGAGTGGGTTGAGCGCGTCCGCGCAGCACCGCAGCGGAACAACCCGGCTTCCACTCTTCTGGACTTTCTGGAC
GGAAACTATCTCCGCATGTCGTGCGGCGGCCTCGTCCTGGACGTCAAAAACACGCTCGAGCACTCCAAAACGCTG
GCTGCCGTTGGGCCTGTCAGCGAAGAGGTGGTCCGAAAATACATTCACATCTGGAAGGAAATTGGCTTCTTGAAT
TCATCATCC
Transcript >Ophio5|1446
ATGGATCTCGACTTCAACGCCCTCTTCTACGAGTACCCGACTGTCGGTGATCTCAAGGGCTTCCTCCTGGGCGGC
GCCGCCAGCCCCAACTCGAGCGGACAGTCGACGCCCATGTCGAGCAGCACCGGACCTTCGACTCCTCGCTCTGTT
GCTACCGGGGCGAGCACGCCGGGTCCGGAGATGTTCTCCAAGCTAGACCCTTCCCCCCCCAAGGTCGACTTCCGA
CGCGCCCTCCAGATCATCTCGGAGGAGAGTGGCGTCGCGGTTGAGGACCTCACGGATGAGACCAACTTTGCCGAT
TCGGGAGTCGACTCTCTCTTGTCGCTTGTCATCGTCAGCCGCTATCGTGATGAGCTCGAGCTCGAAATCCAGCAC
GAGTCTCTTTTCCTCGAGTGTCCGACGGTCGCTGACCTGAAGAAGTTGCTGCTGGGAGTCACCTCGACGGCGGCG
CCCTCTCGCCCCCTGCCTCCTCCCGTGGCAGAGCCCCTGTCGACGCCGACGCCTAGCCCCAAGCCCAACACGTCG
AGTTTCGTGCCAGAAAGCAAAGTCGACTTTCGACGCGCCCTCGAGATTATTTCCGAGGAGAGCGGAGTGGCGACG
GAGGATCTGACTGACAACACCAACTTTGCCGACTCCGGTATCGACTCCCTGCTGTCACTCGTCATCGTCAGTCGC
TATCGAGATGAGCTCGAGCTCGATATCCAGCACGAGTCGCTCTTCCTTGAATGCCCTACCGTGGCGGATCTGAAG
AAGCTCCTACTCGGGGATTCGACCACGTCTCAGCCTGTGACGGAGCAGGCCTCAAGCCAGGAGGAGGTGGTCGAC
GACAAGTACTCGGTCACGCGAGTTCACATCGACCAAGCTGAACTCGACGCTCGCAAGAGGGCCGTCGACGTCCTC
GTCCACAAACACACGGCTGGCTTCACGGCTCCCCCCGCTGCTGCTTCGGGCCTGCTCGGCTCACCAAACGATGAC
GACAAGGTCGTCCTCGTCACTGGTGCTTCGGGAAGTCTGGGCGGTCATCTTGTCTATCACATTGCCCAGCTCCCG
GACGTCAAGACGGTGGTGTGTCTGAACCGCGAGAACAAGGAGGAGCCCAACGTTCGGCAGCAAAAGGCGATGAGA
GGAAAGGGCATCCGCTTCCCCGAGTCTCTCAAGCACAAGCTGGTCGTTCTGCAGACGGACAGCGCCAAGCCCATG
TTCGGCCTGTCGTCCAGCGTCTACCAAGGTCTCGTCAACTCGGTCACCCATCTCATCCATAACGCCTGGCCGATG
AGTGCCAAGCGCCCGCTGTCCGGCTTCGAGTCGCAGTTCCAGGTGATGCGTAACCTGATTGACTTTGGCTGCCAC
GTCTCGAGCCGTCGTCCGTCTTCCTTCCAGTTCAGCTTCCAGATGGTGTCGTCCATCGGAGTCGTCGGTCATTAT
GGTCTCGCCAACGCCACAGACACGACGAGGATCATGGTTCCCGAGAAGAGCGTCGACATCGACTCCGTCCTCCCC
AACGGCTACGGCGATGCCAAATGGGGATGCGAGAGGATGCTGGACGAGACGCTACGCAAGCATCCCACCCGCTTC
CGCACCATGGTCGTCCGCCTCGGACAGATTGCCGGCTCCAAGACGAGCGGATACTGGAACCCGATGGAGCATTTC
GGCTTCCTCATCAAGTCTTCTCAGACGCTCAACGCCCTGCCCGATGTCGACGGCACCGTCTTTTGGACCCCCGTC
AACGACATCGCCGCCACCCTCTCGGATCTGGTACTGTCTGACCGAAAACCGCACGCTGTCTATCACATCGAGAAT
CCCGTCGGCCAGTCTTGGCGCGAGACCAACGCCATCTTGGCCGACGCCCTTAAAATTCCCAACCTCATCCCCTTT
AGCGAGTGGGTTGAGCGCGTCCGCGCAGCACCGCAGCGGAACAACCCGGCTTCCACTCTTCTGGACTTTCTGGAC
GGAAACTATCTCCGCATGTCGTGCGGCGGCCTCGTCCTGGACGTCAAAAACACGCTCGAGCACTCCAAAACGCTG
GCTGCCGTTGGGCCTGTCAGCGAAGAGGTGGTCCGAAAATACATTCACATCTGGAAGGAAATTGGCTTCTTGAAT
TCATCATCCTAA
Gene >Ophio5|1446
ATGGATCTCGACTTCAACGCCCTCTTCTACGAGTACCCGACTGTCGGTGATCTCAAGGGCTTCCTCCTGGGCGGC
GCCGCCAGCCCCAACTCGAGCGGACAGTCGACGCCCATGTCGAGCAGCACCGGACCTTCGACTCCTCGCTCTGTT
GCTACCGGGGCGAGCACGCCGGGTCCGGAGATGTTCTCCAAGCTAGACCCTTCCCCCCCCAAGGTCGACTTCCGA
CGCGCCCTCCAGATCATCTCGGAGGAGAGTGGCGTCGCGGTTGAGGACCTCACGGATGAGACCAACTTTGCCGAT
TCGGGAGTCGACTCTCTCTTGTCGCTTGTCATCGTCAGCCGCTATCGTGATGAGCTCGAGCTCGAAATCCAGCAC
GAGTCTCTTTTCCTCGAGTGTCCGACGGTCGCTGACCTGAAGAAGTTGCTGCTGGGAGTCACCTCGACGGCGGCG
CCCTCTCGCCCCCTGCCTCCTCCCGTGGCAGAGCCCCTGTCGACGCCGACGCCTAGCCCCAAGCCCAACACGTCG
AGTTTCGTGCCAGAAAGCAAAGTCGACTTTCGACGCGCCCTCGAGATTATTTCCGAGGAGAGCGGAGTGGCGACG
GAGGATCTGACTGACAACACCAACTTTGCCGACTCCGGTATCGACTCCCTGCTGTCACTCGTCATCGTCAGTCGC
TATCGAGATGAGCTCGAGCTCGATATCCAGCACGAGTCGCTCTTCCTTGAATGCCCTACCGTGGCGGATCTGAAG
AAGCTCCTACTCGGGGATTCGACCACGTCTCAGCCTGTGACGGAGCAGGCCTCAAGCCAGGAGGAGGTGGTCGAC
GACAAGTACTCGGTCACGCGAGTTCACATCGACCAAGCTGAACTCGACGCTCGCAAGAGGGCCGTCGACGTCCTC
GTCCACAAACACACGGCTGGCTTCACGGCTCCCCCCGCTGCTGCTTCGGGCCTGCTCGGCTCACCAAACGATGAC
GACAAGGTCGTCCTCGTCACTGGTGCTTCGGGAAGTCTGGGCGGTCATCTTGTCTATCACATTGCCCAGCTCCCG
GACGTCAAGACGGTGGTGTGTCTGAACCGCGAGAACAAGGAGGAGCCCAACGTTCGGCAGCAAAAGGCGATGAGA
GGAAAGGGCATCCGCTTCCCCGAGTCTCTCAAGCACAAGCTGGTCGTTCTGCAGACGGACAGCGCCAAGCCCATG
TTCGGCCTGTCGTCCAGCGTCTACCAAGGTCTCGTCAACTCGGTCACCCATCTCATCCATAACGCCTGGCCGATG
AGTGCCAAGCGCCCGCTGTCCGGCTTCGAGTCGCAGTTCCAGGTGATGCGTAACCTGATTGACTTTGGCTGCCAC
GTCTCGAGCCGTCGTCCGTCTTCCTTCCAGTTCAGCTTCCAGATGGTGTCGTCCATCGGAGTCGTCGGTCATTAT
GGTCTCGCCAACGCCACAGACACGACGAGGATCATGGTTCCCGAGAAGAGCGTCGACATCGACTCCGTCCTCCCC
AACGGCTACGGCGATGCCAAATGGGGATGCGAGAGGATGCTGGACGAGACGCTACGCAAGCATCCCACCCGCTTC
CGCACCATGGTCGTCCGCCTCGGACAGATTGCCGGCTCCAAGACGAGCGGATACTGGAACCCGATGGAGCATTTC
GGCTTCCTCATCAAGTCTTCTCAGACGCTCAACGCCCTGCCCGATGTCGACGGCACCGTCTTTTGGACCCCCGTC
AACGACATCGCCGCCACCCTCTCGGATCTGGTACTGTCTGACCGAAAACCGCACGCTGTCTATCACATCGAGAAT
CCCGTCGGCCAGTCTTGGCGCGAGACCAACGCCATCTTGGCCGACGCCCTTAAAATTCCCAACCTCATCCCCTTT
AGCGAGTGGGTTGAGCGCGTCCGCGCAGCACCGCAGCGGAACAACCCGGCTTCCACTCTTCTGGACTTTCTGGAC
GGAAACTATCTCCGCATGTCGTGCGGCGGCCTCGTCCTGGACGTCAAAAACACGCTCGAGCACTCCAAAACGCTG
GCTGCCGTTGGGCCTGTCAGCGAAGAGGTGGTCCGAAAATACATTCACATCTGGAAGGAAATTGGCTTCTTGAAT
TCATCATCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail