Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1446
Gene name
Locationscaffold_15:52846..54958
Strand+
Gene length (bp)2112
Transcript length (bp)2112
Coding sequence length (bp)2109
Protein length (aa) 703

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.8E-22 331 576
PF00550 PP-binding Phosphopantetheine attachment site 4.3E-10 78 140
PF00550 PP-binding Phosphopantetheine attachment site 3.8E-10 189 251

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 34 253 2.0E-29
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 31 253 1.0E-20
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 147 255 1.0E-15
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 78 181 2.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 201 633 1.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 34 253 2.0E-29
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 31 253 1.0E-20
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 147 255 1.0E-15
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 78 181 2.0E-15
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 201 633 1.0E-14
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 7 142 7.0E-14
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 136 253 1.0E-12
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 175 699 2.0E-12
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 329 579 3.0E-12
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 209 579 1.0E-10
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 192 649 5.0E-10
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 329 588 2.0E-09
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 202 583 3.0E-09
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 274 630 7.0E-09
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 312 632 1.0E-07
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 312 579 1.0E-07
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 330 632 2.0E-07
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 325 575 6.0E-07
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 325 579 6.0E-07
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 1 175 7.0E-07
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 330 632 7.0E-07
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 319 583 2.0E-06
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 189 690 2.0E-06
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 330 657 3.0E-06
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 319 645 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.7302 0.4923 0.0278 0.1705 0.2061 0.0573 0.0499 0.0874 0.1825 0.0949

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup59
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1119
Ophiocordyceps australis 1348a (Ghana) OphauG2|676
Ophiocordyceps australis 1348a (Ghana) OphauG2|3943
Ophiocordyceps australis 1348a (Ghana) OphauG2|2993
Ophiocordyceps australis 1348a (Ghana) OphauG2|373
Ophiocordyceps australis map64 (Brazil) OphauB2|1594
Ophiocordyceps australis map64 (Brazil) OphauB2|2073
Ophiocordyceps australis map64 (Brazil) OphauB2|3136
Ophiocordyceps australis map64 (Brazil) OphauB2|590
Ophiocordyceps australis map64 (Brazil) OphauB2|8024
Ophiocordyceps camponoti-floridani Ophcf2|06417
Ophiocordyceps camponoti-floridani Ophcf2|02938
Ophiocordyceps camponoti-rufipedis Ophun1|7485
Ophiocordyceps camponoti-rufipedis Ophun1|3498
Ophiocordyceps kimflemingae Ophio5|1446 (this protein)
Ophiocordyceps kimflemingae Ophio5|6649
Ophiocordyceps subramaniannii Hirsu2|6970
Ophiocordyceps subramaniannii Hirsu2|6425
Ophiocordyceps subramaniannii Hirsu2|5821
Ophiocordyceps subramaniannii Hirsu2|3798

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1446
MDLDFNALFYEYPTVGDLKGFLLGGAASPNSSGQSTPMSSSTGPSTPRSVATGASTPGPEMFSKLDPSPPKVDFR
RALQIISEESGVAVEDLTDETNFADSGVDSLLSLVIVSRYRDELELEIQHESLFLECPTVADLKKLLLGVTSTAA
PSRPLPPPVAEPLSTPTPSPKPNTSSFVPESKVDFRRALEIISEESGVATEDLTDNTNFADSGIDSLLSLVIVSR
YRDELELDIQHESLFLECPTVADLKKLLLGDSTTSQPVTEQASSQEEVVDDKYSVTRVHIDQAELDARKRAVDVL
VHKHTAGFTAPPAAASGLLGSPNDDDKVVLVTGASGSLGGHLVYHIAQLPDVKTVVCLNRENKEEPNVRQQKAMR
GKGIRFPESLKHKLVVLQTDSAKPMFGLSSSVYQGLVNSVTHLIHNAWPMSAKRPLSGFESQFQVMRNLIDFGCH
VSSRRPSSFQFSFQMVSSIGVVGHYGLANATDTTRIMVPEKSVDIDSVLPNGYGDAKWGCERMLDETLRKHPTRF
RTMVVRLGQIAGSKTSGYWNPMEHFGFLIKSSQTLNALPDVDGTVFWTPVNDIAATLSDLVLSDRKPHAVYHIEN
PVGQSWRETNAILADALKIPNLIPFSEWVERVRAAPQRNNPASTLLDFLDGNYLRMSCGGLVLDVKNTLEHSKTL
AAVGPVSEEVVRKYIHIWKEIGFLNSSS
Coding >Ophio5|1446
ATGGATCTCGACTTCAACGCCCTCTTCTACGAGTACCCGACTGTCGGTGATCTCAAGGGCTTCCTCCTGGGCGGC
GCCGCCAGCCCCAACTCGAGCGGACAGTCGACGCCCATGTCGAGCAGCACCGGACCTTCGACTCCTCGCTCTGTT
GCTACCGGGGCGAGCACGCCGGGTCCGGAGATGTTCTCCAAGCTAGACCCTTCCCCCCCCAAGGTCGACTTCCGA
CGCGCCCTCCAGATCATCTCGGAGGAGAGTGGCGTCGCGGTTGAGGACCTCACGGATGAGACCAACTTTGCCGAT
TCGGGAGTCGACTCTCTCTTGTCGCTTGTCATCGTCAGCCGCTATCGTGATGAGCTCGAGCTCGAAATCCAGCAC
GAGTCTCTTTTCCTCGAGTGTCCGACGGTCGCTGACCTGAAGAAGTTGCTGCTGGGAGTCACCTCGACGGCGGCG
CCCTCTCGCCCCCTGCCTCCTCCCGTGGCAGAGCCCCTGTCGACGCCGACGCCTAGCCCCAAGCCCAACACGTCG
AGTTTCGTGCCAGAAAGCAAAGTCGACTTTCGACGCGCCCTCGAGATTATTTCCGAGGAGAGCGGAGTGGCGACG
GAGGATCTGACTGACAACACCAACTTTGCCGACTCCGGTATCGACTCCCTGCTGTCACTCGTCATCGTCAGTCGC
TATCGAGATGAGCTCGAGCTCGATATCCAGCACGAGTCGCTCTTCCTTGAATGCCCTACCGTGGCGGATCTGAAG
AAGCTCCTACTCGGGGATTCGACCACGTCTCAGCCTGTGACGGAGCAGGCCTCAAGCCAGGAGGAGGTGGTCGAC
GACAAGTACTCGGTCACGCGAGTTCACATCGACCAAGCTGAACTCGACGCTCGCAAGAGGGCCGTCGACGTCCTC
GTCCACAAACACACGGCTGGCTTCACGGCTCCCCCCGCTGCTGCTTCGGGCCTGCTCGGCTCACCAAACGATGAC
GACAAGGTCGTCCTCGTCACTGGTGCTTCGGGAAGTCTGGGCGGTCATCTTGTCTATCACATTGCCCAGCTCCCG
GACGTCAAGACGGTGGTGTGTCTGAACCGCGAGAACAAGGAGGAGCCCAACGTTCGGCAGCAAAAGGCGATGAGA
GGAAAGGGCATCCGCTTCCCCGAGTCTCTCAAGCACAAGCTGGTCGTTCTGCAGACGGACAGCGCCAAGCCCATG
TTCGGCCTGTCGTCCAGCGTCTACCAAGGTCTCGTCAACTCGGTCACCCATCTCATCCATAACGCCTGGCCGATG
AGTGCCAAGCGCCCGCTGTCCGGCTTCGAGTCGCAGTTCCAGGTGATGCGTAACCTGATTGACTTTGGCTGCCAC
GTCTCGAGCCGTCGTCCGTCTTCCTTCCAGTTCAGCTTCCAGATGGTGTCGTCCATCGGAGTCGTCGGTCATTAT
GGTCTCGCCAACGCCACAGACACGACGAGGATCATGGTTCCCGAGAAGAGCGTCGACATCGACTCCGTCCTCCCC
AACGGCTACGGCGATGCCAAATGGGGATGCGAGAGGATGCTGGACGAGACGCTACGCAAGCATCCCACCCGCTTC
CGCACCATGGTCGTCCGCCTCGGACAGATTGCCGGCTCCAAGACGAGCGGATACTGGAACCCGATGGAGCATTTC
GGCTTCCTCATCAAGTCTTCTCAGACGCTCAACGCCCTGCCCGATGTCGACGGCACCGTCTTTTGGACCCCCGTC
AACGACATCGCCGCCACCCTCTCGGATCTGGTACTGTCTGACCGAAAACCGCACGCTGTCTATCACATCGAGAAT
CCCGTCGGCCAGTCTTGGCGCGAGACCAACGCCATCTTGGCCGACGCCCTTAAAATTCCCAACCTCATCCCCTTT
AGCGAGTGGGTTGAGCGCGTCCGCGCAGCACCGCAGCGGAACAACCCGGCTTCCACTCTTCTGGACTTTCTGGAC
GGAAACTATCTCCGCATGTCGTGCGGCGGCCTCGTCCTGGACGTCAAAAACACGCTCGAGCACTCCAAAACGCTG
GCTGCCGTTGGGCCTGTCAGCGAAGAGGTGGTCCGAAAATACATTCACATCTGGAAGGAAATTGGCTTCTTGAAT
TCATCATCC
Transcript >Ophio5|1446
ATGGATCTCGACTTCAACGCCCTCTTCTACGAGTACCCGACTGTCGGTGATCTCAAGGGCTTCCTCCTGGGCGGC
GCCGCCAGCCCCAACTCGAGCGGACAGTCGACGCCCATGTCGAGCAGCACCGGACCTTCGACTCCTCGCTCTGTT
GCTACCGGGGCGAGCACGCCGGGTCCGGAGATGTTCTCCAAGCTAGACCCTTCCCCCCCCAAGGTCGACTTCCGA
CGCGCCCTCCAGATCATCTCGGAGGAGAGTGGCGTCGCGGTTGAGGACCTCACGGATGAGACCAACTTTGCCGAT
TCGGGAGTCGACTCTCTCTTGTCGCTTGTCATCGTCAGCCGCTATCGTGATGAGCTCGAGCTCGAAATCCAGCAC
GAGTCTCTTTTCCTCGAGTGTCCGACGGTCGCTGACCTGAAGAAGTTGCTGCTGGGAGTCACCTCGACGGCGGCG
CCCTCTCGCCCCCTGCCTCCTCCCGTGGCAGAGCCCCTGTCGACGCCGACGCCTAGCCCCAAGCCCAACACGTCG
AGTTTCGTGCCAGAAAGCAAAGTCGACTTTCGACGCGCCCTCGAGATTATTTCCGAGGAGAGCGGAGTGGCGACG
GAGGATCTGACTGACAACACCAACTTTGCCGACTCCGGTATCGACTCCCTGCTGTCACTCGTCATCGTCAGTCGC
TATCGAGATGAGCTCGAGCTCGATATCCAGCACGAGTCGCTCTTCCTTGAATGCCCTACCGTGGCGGATCTGAAG
AAGCTCCTACTCGGGGATTCGACCACGTCTCAGCCTGTGACGGAGCAGGCCTCAAGCCAGGAGGAGGTGGTCGAC
GACAAGTACTCGGTCACGCGAGTTCACATCGACCAAGCTGAACTCGACGCTCGCAAGAGGGCCGTCGACGTCCTC
GTCCACAAACACACGGCTGGCTTCACGGCTCCCCCCGCTGCTGCTTCGGGCCTGCTCGGCTCACCAAACGATGAC
GACAAGGTCGTCCTCGTCACTGGTGCTTCGGGAAGTCTGGGCGGTCATCTTGTCTATCACATTGCCCAGCTCCCG
GACGTCAAGACGGTGGTGTGTCTGAACCGCGAGAACAAGGAGGAGCCCAACGTTCGGCAGCAAAAGGCGATGAGA
GGAAAGGGCATCCGCTTCCCCGAGTCTCTCAAGCACAAGCTGGTCGTTCTGCAGACGGACAGCGCCAAGCCCATG
TTCGGCCTGTCGTCCAGCGTCTACCAAGGTCTCGTCAACTCGGTCACCCATCTCATCCATAACGCCTGGCCGATG
AGTGCCAAGCGCCCGCTGTCCGGCTTCGAGTCGCAGTTCCAGGTGATGCGTAACCTGATTGACTTTGGCTGCCAC
GTCTCGAGCCGTCGTCCGTCTTCCTTCCAGTTCAGCTTCCAGATGGTGTCGTCCATCGGAGTCGTCGGTCATTAT
GGTCTCGCCAACGCCACAGACACGACGAGGATCATGGTTCCCGAGAAGAGCGTCGACATCGACTCCGTCCTCCCC
AACGGCTACGGCGATGCCAAATGGGGATGCGAGAGGATGCTGGACGAGACGCTACGCAAGCATCCCACCCGCTTC
CGCACCATGGTCGTCCGCCTCGGACAGATTGCCGGCTCCAAGACGAGCGGATACTGGAACCCGATGGAGCATTTC
GGCTTCCTCATCAAGTCTTCTCAGACGCTCAACGCCCTGCCCGATGTCGACGGCACCGTCTTTTGGACCCCCGTC
AACGACATCGCCGCCACCCTCTCGGATCTGGTACTGTCTGACCGAAAACCGCACGCTGTCTATCACATCGAGAAT
CCCGTCGGCCAGTCTTGGCGCGAGACCAACGCCATCTTGGCCGACGCCCTTAAAATTCCCAACCTCATCCCCTTT
AGCGAGTGGGTTGAGCGCGTCCGCGCAGCACCGCAGCGGAACAACCCGGCTTCCACTCTTCTGGACTTTCTGGAC
GGAAACTATCTCCGCATGTCGTGCGGCGGCCTCGTCCTGGACGTCAAAAACACGCTCGAGCACTCCAAAACGCTG
GCTGCCGTTGGGCCTGTCAGCGAAGAGGTGGTCCGAAAATACATTCACATCTGGAAGGAAATTGGCTTCTTGAAT
TCATCATCCTAA
Gene >Ophio5|1446
ATGGATCTCGACTTCAACGCCCTCTTCTACGAGTACCCGACTGTCGGTGATCTCAAGGGCTTCCTCCTGGGCGGC
GCCGCCAGCCCCAACTCGAGCGGACAGTCGACGCCCATGTCGAGCAGCACCGGACCTTCGACTCCTCGCTCTGTT
GCTACCGGGGCGAGCACGCCGGGTCCGGAGATGTTCTCCAAGCTAGACCCTTCCCCCCCCAAGGTCGACTTCCGA
CGCGCCCTCCAGATCATCTCGGAGGAGAGTGGCGTCGCGGTTGAGGACCTCACGGATGAGACCAACTTTGCCGAT
TCGGGAGTCGACTCTCTCTTGTCGCTTGTCATCGTCAGCCGCTATCGTGATGAGCTCGAGCTCGAAATCCAGCAC
GAGTCTCTTTTCCTCGAGTGTCCGACGGTCGCTGACCTGAAGAAGTTGCTGCTGGGAGTCACCTCGACGGCGGCG
CCCTCTCGCCCCCTGCCTCCTCCCGTGGCAGAGCCCCTGTCGACGCCGACGCCTAGCCCCAAGCCCAACACGTCG
AGTTTCGTGCCAGAAAGCAAAGTCGACTTTCGACGCGCCCTCGAGATTATTTCCGAGGAGAGCGGAGTGGCGACG
GAGGATCTGACTGACAACACCAACTTTGCCGACTCCGGTATCGACTCCCTGCTGTCACTCGTCATCGTCAGTCGC
TATCGAGATGAGCTCGAGCTCGATATCCAGCACGAGTCGCTCTTCCTTGAATGCCCTACCGTGGCGGATCTGAAG
AAGCTCCTACTCGGGGATTCGACCACGTCTCAGCCTGTGACGGAGCAGGCCTCAAGCCAGGAGGAGGTGGTCGAC
GACAAGTACTCGGTCACGCGAGTTCACATCGACCAAGCTGAACTCGACGCTCGCAAGAGGGCCGTCGACGTCCTC
GTCCACAAACACACGGCTGGCTTCACGGCTCCCCCCGCTGCTGCTTCGGGCCTGCTCGGCTCACCAAACGATGAC
GACAAGGTCGTCCTCGTCACTGGTGCTTCGGGAAGTCTGGGCGGTCATCTTGTCTATCACATTGCCCAGCTCCCG
GACGTCAAGACGGTGGTGTGTCTGAACCGCGAGAACAAGGAGGAGCCCAACGTTCGGCAGCAAAAGGCGATGAGA
GGAAAGGGCATCCGCTTCCCCGAGTCTCTCAAGCACAAGCTGGTCGTTCTGCAGACGGACAGCGCCAAGCCCATG
TTCGGCCTGTCGTCCAGCGTCTACCAAGGTCTCGTCAACTCGGTCACCCATCTCATCCATAACGCCTGGCCGATG
AGTGCCAAGCGCCCGCTGTCCGGCTTCGAGTCGCAGTTCCAGGTGATGCGTAACCTGATTGACTTTGGCTGCCAC
GTCTCGAGCCGTCGTCCGTCTTCCTTCCAGTTCAGCTTCCAGATGGTGTCGTCCATCGGAGTCGTCGGTCATTAT
GGTCTCGCCAACGCCACAGACACGACGAGGATCATGGTTCCCGAGAAGAGCGTCGACATCGACTCCGTCCTCCCC
AACGGCTACGGCGATGCCAAATGGGGATGCGAGAGGATGCTGGACGAGACGCTACGCAAGCATCCCACCCGCTTC
CGCACCATGGTCGTCCGCCTCGGACAGATTGCCGGCTCCAAGACGAGCGGATACTGGAACCCGATGGAGCATTTC
GGCTTCCTCATCAAGTCTTCTCAGACGCTCAACGCCCTGCCCGATGTCGACGGCACCGTCTTTTGGACCCCCGTC
AACGACATCGCCGCCACCCTCTCGGATCTGGTACTGTCTGACCGAAAACCGCACGCTGTCTATCACATCGAGAAT
CCCGTCGGCCAGTCTTGGCGCGAGACCAACGCCATCTTGGCCGACGCCCTTAAAATTCCCAACCTCATCCCCTTT
AGCGAGTGGGTTGAGCGCGTCCGCGCAGCACCGCAGCGGAACAACCCGGCTTCCACTCTTCTGGACTTTCTGGAC
GGAAACTATCTCCGCATGTCGTGCGGCGGCCTCGTCCTGGACGTCAAAAACACGCTCGAGCACTCCAAAACGCTG
GCTGCCGTTGGGCCTGTCAGCGAAGAGGTGGTCCGAAAATACATTCACATCTGGAAGGAAATTGGCTTCTTGAAT
TCATCATCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail