Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1428
Gene name
Locationscaffold_15:10037..11583
Strand-
Gene length (bp)1546
Transcript length (bp)1281
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 8.5E-14 244 297

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 137 333 2.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 167 189 22
2 210 232 22
3 242 264 22
4 271 293 22
5 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 54.77 29.62 79.93
CcL In ants, during behavior modification 54.91 29.06 80.76
CcD In ants, recently dead 63.60 34.65 92.55

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.993148 no
SC16a CcD 0.561529 no
CcL CcD 0.566652 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1428
MESFEYRTIQYPGHPLVTCLDDETAASQPRRYSHRCIQPRLRPHHARIAARLAPARQSLAVSRRLSPSPPPATER
HDHLLSPADAPAFLASSRLPKPGKPWAISGSWMAPGASGSGRRRIWSLSSPLSSSSDYSSRFANILTVPPSREAI
GCCRELGAFDCAAGLLGVAQLGVQWLCFTLILILFLIFFRYREANVPQGELGGESPKWQTAVAVGLLCVLHGLIV
VILTGVFAMALPSHLTAWANALGVMAALLAAVQYVPQIWMTYRLKHVGSLSIPMMCIQTPGGFLFAASLFARLGL
AGWSTWVIYLLTATMQGVVLVLGVYYEMASRRQDGHPVDFVGGVPRSPLEHSPSSQRPAASRTYSEGWERGLPGP
FTGHPERYAETEEDLDHMQEREARAIARENQPLLRPGGIGNPRRNYGSSRG
Coding >Ophio5|1428
ATGGAGTCGTTCGAGTATCGGACTATTCAATATCCGGGTCATCCTCTCGTCACGTGCCTCGATGATGAAACTGCG
GCCAGCCAGCCTCGTCGGTACTCCCATCGATGCATTCAGCCTCGCCTCCGCCCGCATCACGCCCGCATCGCCGCC
CGCCTTGCGCCTGCTCGCCAGTCGTTAGCCGTTAGCCGTCGTCTGTCTCCTTCTCCGCCGCCCGCTACCGAGCGT
CATGATCATCTACTGAGTCCTGCTGACGCGCCGGCATTTCTCGCTTCGAGTCGCCTGCCAAAACCCGGCAAGCCA
TGGGCCATCTCTGGGAGCTGGATGGCGCCGGGTGCGAGCGGCTCCGGTCGCCGTCGTATCTGGAGCTTGTCGTCT
CCATTGTCATCCTCATCGGACTACTCCTCTCGCTTCGCCAACATTCTCACCGTCCCGCCCTCGCGTGAGGCCATC
GGCTGCTGCAGGGAGCTGGGCGCATTCGACTGCGCCGCGGGTCTACTCGGCGTCGCCCAGCTCGGGGTACAATGG
CTGTGCTTTACTCTGATCCTCATCCTCTTCCTCATCTTCTTCCGCTACCGCGAAGCCAATGTGCCCCAGGGCGAG
CTAGGCGGAGAGTCGCCAAAGTGGCAGACGGCCGTCGCCGTCGGTCTTTTATGCGTCTTGCACGGACTAATTGTC
GTCATCCTCACCGGCGTCTTCGCTATGGCATTACCTAGCCATCTAACTGCGTGGGCCAACGCCCTCGGCGTCATG
GCTGCACTCCTCGCCGCCGTACAGTACGTGCCACAGATCTGGATGACGTATCGCCTCAAGCACGTCGGGAGTCTG
AGTATCCCCATGATGTGCATCCAAACACCTGGCGGCTTCCTCTTTGCTGCCAGTCTCTTCGCCCGGCTTGGGCTT
GCCGGTTGGAGCACTTGGGTCATTTACCTCTTGACGGCAACCATGCAGGGTGTCGTTCTCGTACTCGGCGTTTAC
TATGAGATGGCGTCCCGTCGACAGGACGGCCACCCGGTCGACTTCGTCGGAGGCGTGCCGCGCTCGCCGCTGGAA
CATTCTCCCTCATCACAGCGGCCGGCCGCGAGCCGCACATACTCTGAGGGCTGGGAGCGCGGGTTGCCGGGGCCC
TTTACCGGCCATCCAGAGCGCTACGCCGAGACGGAGGAGGACCTCGACCACATGCAAGAGCGGGAAGCGCGAGCC
ATTGCGCGGGAGAACCAGCCGTTGCTTCGACCCGGTGGCATTGGCAACCCGCGTCGGAATTATGGCTCGAGTCGC
GGT
Transcript >Ophio5|1428
ATGGAGTCGTTCGAGTATCGGACTATTCAATATCCGGGTCATCCTCTCGTCACGTGCCTCGATGATGAAACTGCG
GCCAGCCAGCCTCGTCGGTACTCCCATCGATGCATTCAGCCTCGCCTCCGCCCGCATCACGCCCGCATCGCCGCC
CGCCTTGCGCCTGCTCGCCAGTCGTTAGCCGTTAGCCGTCGTCTGTCTCCTTCTCCGCCGCCCGCTACCGAGCGT
CATGATCATCTACTGAGTCCTGCTGACGCGCCGGCATTTCTCGCTTCGAGTCGCCTGCCAAAACCCGGCAAGCCA
TGGGCCATCTCTGGGAGCTGGATGGCGCCGGGTGCGAGCGGCTCCGGTCGCCGTCGTATCTGGAGCTTGTCGTCT
CCATTGTCATCCTCATCGGACTACTCCTCTCGCTTCGCCAACATTCTCACCGTCCCGCCCTCGCGTGAGGCCATC
GGCTGCTGCAGGGAGCTGGGCGCATTCGACTGCGCCGCGGGTCTACTCGGCGTCGCCCAGCTCGGGGTACAATGG
CTGTGCTTTACTCTGATCCTCATCCTCTTCCTCATCTTCTTCCGCTACCGCGAAGCCAATGTGCCCCAGGGCGAG
CTAGGCGGAGAGTCGCCAAAGTGGCAGACGGCCGTCGCCGTCGGTCTTTTATGCGTCTTGCACGGACTAATTGTC
GTCATCCTCACCGGCGTCTTCGCTATGGCATTACCTAGCCATCTAACTGCGTGGGCCAACGCCCTCGGCGTCATG
GCTGCACTCCTCGCCGCCGTACAGTACGTGCCACAGATCTGGATGACGTATCGCCTCAAGCACGTCGGGAGTCTG
AGTATCCCCATGATGTGCATCCAAACACCTGGCGGCTTCCTCTTTGCTGCCAGTCTCTTCGCCCGGCTTGGGCTT
GCCGGTTGGAGCACTTGGGTCATTTACCTCTTGACGGCAACCATGCAGGGTGTCGTTCTCGTACTCGGCGTTTAC
TATGAGATGGCGTCCCGTCGACAGGACGGCCACCCGGTCGACTTCGTCGGAGGCGTGCCGCGCTCGCCGCTGGAA
CATTCTCCCTCATCACAGCGGCCGGCCGCGAGCCGCACATACTCTGAGGGCTGGGAGCGCGGGTTGCCGGGGCCC
TTTACCGGCCATCCAGAGCGCTACGCCGAGACGGAGGAGGACCTCGACCACATGCAAGAGCGGGAAGCGCGAGCC
ATTGCGCGGGAGAACCAGCCGTTGCTTCGACCCGGTGGCATTGGCAACCCGCGTCGGAATTATGGCTCGAGTCGC
GGTTGA
Gene >Ophio5|1428
ATGGAGTCGTTCGAGTATCGGACTATTCAATATCCGGGTCATCCTCTCGTCACGTGCCTCGATGATGAAACTGCG
GCCAGCCAGCCTCGTCGGTACTCCCATCGATGCATTCAGCCTCGCCTCCGCCCGCATCACGCCCGCATCGCCGCC
CGCCTTGCGCCTGCTCGCCAGTCGTTAGCCGTTAGCCGTCGTCTGTCTCCTTCTCCGCCGCCCGCTACCGAGCGT
CATGATCATCTACTGAGTCCTGCTGACGCGCCGGCATTTCTCGCGTTCTCTCTTCCCCCCTCTTCCTTTGCTTTC
CCCCTTACTCACGCCCTTGCTCAGTTCGAGTCGCCTGCCAAAACCCGGCAAGCCATGGGCCATCTCTGGGAGCTG
GATGGCGCCGGGTGCGAGCGGCTCCGGTCGCCGTCGTATCTGGAGCTTGTCGTCTCCATGTGCGAAGCATCCCAT
CTGGCCTCCCTTTTCAATGTCTCATCCAGCTGACGCCGGCTACAGTGTCATCCTCATCGGACTACTCCTCTCGTA
CCTCCCACAGCACTACCGAATCGTTTCCCGAGGCACCTCGGAGGGAATATCACCTTACTTCGTTCTTCTCGGCAC
CACCTCTGCCACCGCAGGCTTCGCCAACATTCTCACCGTCCCGCCCTCGCGTGAGGCCATCGGCTGCTGCAGGGA
GCTGGGCGCATTCGACTGCGCCGCGGGTCTACTCGGCGTCGCCCAGCTCGGGGTACAATGGCTGTGCTTTACTCT
GATGTAGGCGGTTCCCGAGGTGAGAGCATGCGTGTGCTCGCCGCTGACTCTTCGCAGCCTCATCCTCTTCCTCAT
CTTCTTCCGCTACCGCGAAGCCAATGTGCCCCAGGGCGAGCTAGGCGGAGAGTCGCCAAAGTGGCAGACGGCCGT
CGCCGTCGGTCTTTTATGCGTCTTGCACGGACTAATTGTCGTCATCCTCACCGGCGTCTTCGCTATGGCATTACC
TAGCCATCTAACTGCGTGGGCCAACGCCCTCGGCGTCATGGCTGCACTCCTCGCCGCCGTACAGTACGTGCCACA
GATCTGGATGACGTATCGCCTCAAGCACGTCGGGAGTCTGAGTATCCCCATGATGTGCATCCAAACACCTGGCGG
CTTCCTCTTTGCTGCCAGTCTCTTCGCCCGGCTTGGGCTTGCCGGTTGGAGCACTTGGGTCATTTACCTCTTGAC
GGCAACCATGCAGGGTGTCGTTCTCGTACTCGGCGTTTACTATGAGATGGCGTCCCGTCGACAGGACGGCCACCC
GGTCGACTTCGTCGGAGGCGTGCCGCGCTCGCCGCTGGAACATTCTCCCTCATCACAGCGGCCGGCCGCGAGCCG
CACATACTCTGAGGGCTGGGAGCGCGGGTTGCCGGGGCCCTTTACCGGCCATCCAGAGCGCTACGCCGAGACGGA
GGAGGACCTCGACCACATGCAAGAGCGGGAAGCGCGAGCCATTGCGCGGGAGAACCAGCCGTTGCTTCGACCCGG
TGGCATTGGCAACCCGCGTCGGAATTATGGCTCGAGTCGCGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail