Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1428
Gene name
Locationscaffold_15:10037..11583
Strand-
Gene length (bp)1546
Transcript length (bp)1281
Coding sequence length (bp)1278
Protein length (aa) 426

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04193 PQ-loop PQ loop repeat 8.5E-14 244 297

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O14166|YDX3_SCHPO Uncharacterized protein C4C5.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4C5.03 PE=4 SV=1 137 333 2.0E-21

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 48 0.45

Transmembrane Domains

Domain # Start End Length
1 167 189 22
2 210 232 22
3 242 264 22
4 271 293 22
5 303 325 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1428
MESFEYRTIQYPGHPLVTCLDDETAASQPRRYSHRCIQPRLRPHHARIAARLAPARQSLAVSRRLSPSPPPATER
HDHLLSPADAPAFLASSRLPKPGKPWAISGSWMAPGASGSGRRRIWSLSSPLSSSSDYSSRFANILTVPPSREAI
GCCRELGAFDCAAGLLGVAQLGVQWLCFTLILILFLIFFRYREANVPQGELGGESPKWQTAVAVGLLCVLHGLIV
VILTGVFAMALPSHLTAWANALGVMAALLAAVQYVPQIWMTYRLKHVGSLSIPMMCIQTPGGFLFAASLFARLGL
AGWSTWVIYLLTATMQGVVLVLGVYYEMASRRQDGHPVDFVGGVPRSPLEHSPSSQRPAASRTYSEGWERGLPGP
FTGHPERYAETEEDLDHMQEREARAIARENQPLLRPGGIGNPRRNYGSSRG
Coding >Ophio5|1428
ATGGAGTCGTTCGAGTATCGGACTATTCAATATCCGGGTCATCCTCTCGTCACGTGCCTCGATGATGAAACTGCG
GCCAGCCAGCCTCGTCGGTACTCCCATCGATGCATTCAGCCTCGCCTCCGCCCGCATCACGCCCGCATCGCCGCC
CGCCTTGCGCCTGCTCGCCAGTCGTTAGCCGTTAGCCGTCGTCTGTCTCCTTCTCCGCCGCCCGCTACCGAGCGT
CATGATCATCTACTGAGTCCTGCTGACGCGCCGGCATTTCTCGCTTCGAGTCGCCTGCCAAAACCCGGCAAGCCA
TGGGCCATCTCTGGGAGCTGGATGGCGCCGGGTGCGAGCGGCTCCGGTCGCCGTCGTATCTGGAGCTTGTCGTCT
CCATTGTCATCCTCATCGGACTACTCCTCTCGCTTCGCCAACATTCTCACCGTCCCGCCCTCGCGTGAGGCCATC
GGCTGCTGCAGGGAGCTGGGCGCATTCGACTGCGCCGCGGGTCTACTCGGCGTCGCCCAGCTCGGGGTACAATGG
CTGTGCTTTACTCTGATCCTCATCCTCTTCCTCATCTTCTTCCGCTACCGCGAAGCCAATGTGCCCCAGGGCGAG
CTAGGCGGAGAGTCGCCAAAGTGGCAGACGGCCGTCGCCGTCGGTCTTTTATGCGTCTTGCACGGACTAATTGTC
GTCATCCTCACCGGCGTCTTCGCTATGGCATTACCTAGCCATCTAACTGCGTGGGCCAACGCCCTCGGCGTCATG
GCTGCACTCCTCGCCGCCGTACAGTACGTGCCACAGATCTGGATGACGTATCGCCTCAAGCACGTCGGGAGTCTG
AGTATCCCCATGATGTGCATCCAAACACCTGGCGGCTTCCTCTTTGCTGCCAGTCTCTTCGCCCGGCTTGGGCTT
GCCGGTTGGAGCACTTGGGTCATTTACCTCTTGACGGCAACCATGCAGGGTGTCGTTCTCGTACTCGGCGTTTAC
TATGAGATGGCGTCCCGTCGACAGGACGGCCACCCGGTCGACTTCGTCGGAGGCGTGCCGCGCTCGCCGCTGGAA
CATTCTCCCTCATCACAGCGGCCGGCCGCGAGCCGCACATACTCTGAGGGCTGGGAGCGCGGGTTGCCGGGGCCC
TTTACCGGCCATCCAGAGCGCTACGCCGAGACGGAGGAGGACCTCGACCACATGCAAGAGCGGGAAGCGCGAGCC
ATTGCGCGGGAGAACCAGCCGTTGCTTCGACCCGGTGGCATTGGCAACCCGCGTCGGAATTATGGCTCGAGTCGC
GGT
Transcript >Ophio5|1428
ATGGAGTCGTTCGAGTATCGGACTATTCAATATCCGGGTCATCCTCTCGTCACGTGCCTCGATGATGAAACTGCG
GCCAGCCAGCCTCGTCGGTACTCCCATCGATGCATTCAGCCTCGCCTCCGCCCGCATCACGCCCGCATCGCCGCC
CGCCTTGCGCCTGCTCGCCAGTCGTTAGCCGTTAGCCGTCGTCTGTCTCCTTCTCCGCCGCCCGCTACCGAGCGT
CATGATCATCTACTGAGTCCTGCTGACGCGCCGGCATTTCTCGCTTCGAGTCGCCTGCCAAAACCCGGCAAGCCA
TGGGCCATCTCTGGGAGCTGGATGGCGCCGGGTGCGAGCGGCTCCGGTCGCCGTCGTATCTGGAGCTTGTCGTCT
CCATTGTCATCCTCATCGGACTACTCCTCTCGCTTCGCCAACATTCTCACCGTCCCGCCCTCGCGTGAGGCCATC
GGCTGCTGCAGGGAGCTGGGCGCATTCGACTGCGCCGCGGGTCTACTCGGCGTCGCCCAGCTCGGGGTACAATGG
CTGTGCTTTACTCTGATCCTCATCCTCTTCCTCATCTTCTTCCGCTACCGCGAAGCCAATGTGCCCCAGGGCGAG
CTAGGCGGAGAGTCGCCAAAGTGGCAGACGGCCGTCGCCGTCGGTCTTTTATGCGTCTTGCACGGACTAATTGTC
GTCATCCTCACCGGCGTCTTCGCTATGGCATTACCTAGCCATCTAACTGCGTGGGCCAACGCCCTCGGCGTCATG
GCTGCACTCCTCGCCGCCGTACAGTACGTGCCACAGATCTGGATGACGTATCGCCTCAAGCACGTCGGGAGTCTG
AGTATCCCCATGATGTGCATCCAAACACCTGGCGGCTTCCTCTTTGCTGCCAGTCTCTTCGCCCGGCTTGGGCTT
GCCGGTTGGAGCACTTGGGTCATTTACCTCTTGACGGCAACCATGCAGGGTGTCGTTCTCGTACTCGGCGTTTAC
TATGAGATGGCGTCCCGTCGACAGGACGGCCACCCGGTCGACTTCGTCGGAGGCGTGCCGCGCTCGCCGCTGGAA
CATTCTCCCTCATCACAGCGGCCGGCCGCGAGCCGCACATACTCTGAGGGCTGGGAGCGCGGGTTGCCGGGGCCC
TTTACCGGCCATCCAGAGCGCTACGCCGAGACGGAGGAGGACCTCGACCACATGCAAGAGCGGGAAGCGCGAGCC
ATTGCGCGGGAGAACCAGCCGTTGCTTCGACCCGGTGGCATTGGCAACCCGCGTCGGAATTATGGCTCGAGTCGC
GGTTGA
Gene >Ophio5|1428
ATGGAGTCGTTCGAGTATCGGACTATTCAATATCCGGGTCATCCTCTCGTCACGTGCCTCGATGATGAAACTGCG
GCCAGCCAGCCTCGTCGGTACTCCCATCGATGCATTCAGCCTCGCCTCCGCCCGCATCACGCCCGCATCGCCGCC
CGCCTTGCGCCTGCTCGCCAGTCGTTAGCCGTTAGCCGTCGTCTGTCTCCTTCTCCGCCGCCCGCTACCGAGCGT
CATGATCATCTACTGAGTCCTGCTGACGCGCCGGCATTTCTCGCGTTCTCTCTTCCCCCCTCTTCCTTTGCTTTC
CCCCTTACTCACGCCCTTGCTCAGTTCGAGTCGCCTGCCAAAACCCGGCAAGCCATGGGCCATCTCTGGGAGCTG
GATGGCGCCGGGTGCGAGCGGCTCCGGTCGCCGTCGTATCTGGAGCTTGTCGTCTCCATGTGCGAAGCATCCCAT
CTGGCCTCCCTTTTCAATGTCTCATCCAGCTGACGCCGGCTACAGTGTCATCCTCATCGGACTACTCCTCTCGTA
CCTCCCACAGCACTACCGAATCGTTTCCCGAGGCACCTCGGAGGGAATATCACCTTACTTCGTTCTTCTCGGCAC
CACCTCTGCCACCGCAGGCTTCGCCAACATTCTCACCGTCCCGCCCTCGCGTGAGGCCATCGGCTGCTGCAGGGA
GCTGGGCGCATTCGACTGCGCCGCGGGTCTACTCGGCGTCGCCCAGCTCGGGGTACAATGGCTGTGCTTTACTCT
GATGTAGGCGGTTCCCGAGGTGAGAGCATGCGTGTGCTCGCCGCTGACTCTTCGCAGCCTCATCCTCTTCCTCAT
CTTCTTCCGCTACCGCGAAGCCAATGTGCCCCAGGGCGAGCTAGGCGGAGAGTCGCCAAAGTGGCAGACGGCCGT
CGCCGTCGGTCTTTTATGCGTCTTGCACGGACTAATTGTCGTCATCCTCACCGGCGTCTTCGCTATGGCATTACC
TAGCCATCTAACTGCGTGGGCCAACGCCCTCGGCGTCATGGCTGCACTCCTCGCCGCCGTACAGTACGTGCCACA
GATCTGGATGACGTATCGCCTCAAGCACGTCGGGAGTCTGAGTATCCCCATGATGTGCATCCAAACACCTGGCGG
CTTCCTCTTTGCTGCCAGTCTCTTCGCCCGGCTTGGGCTTGCCGGTTGGAGCACTTGGGTCATTTACCTCTTGAC
GGCAACCATGCAGGGTGTCGTTCTCGTACTCGGCGTTTACTATGAGATGGCGTCCCGTCGACAGGACGGCCACCC
GGTCGACTTCGTCGGAGGCGTGCCGCGCTCGCCGCTGGAACATTCTCCCTCATCACAGCGGCCGGCCGCGAGCCG
CACATACTCTGAGGGCTGGGAGCGCGGGTTGCCGGGGCCCTTTACCGGCCATCCAGAGCGCTACGCCGAGACGGA
GGAGGACCTCGACCACATGCAAGAGCGGGAAGCGCGAGCCATTGCGCGGGAGAACCAGCCGTTGCTTCGACCCGG
TGGCATTGGCAACCCGCGTCGGAATTATGGCTCGAGTCGCGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail