Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1417
Gene name
Locationscaffold_149:24111..27200
Strand-
Gene length (bp)3089
Transcript length (bp)2784
Coding sequence length (bp)2781
Protein length (aa) 927

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03124 EXS EXS family 4.3E-98 432 757
PF03105 SPX SPX domain 1.1E-71 1 338

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU86|SYG1_SCHPO Protein SYG1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.07c PE=3 SV=1 168 780 4.0E-97
sp|P40528|SYG1_YEAST Protein SYG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYG1 PE=1 SV=1 173 788 1.0E-71
sp|Q8S403|PHO1_ARATH Phosphate transporter PHO1 OS=Arabidopsis thaliana GN=PHO1 PE=2 SV=1 1 784 1.0E-56
sp|Q54MJ9|SPXS3_DICDI SPX and EXS domain-containing protein 3 OS=Dictyostelium discoideum GN=xpr1 PE=3 SV=1 1 772 3.0E-56
sp|Q6R8G0|PHO1A_ARATH Phosphate transporter PHO1 homolog 10 OS=Arabidopsis thaliana GN=PHO1-H10 PE=2 SV=1 170 773 2.0E-54
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UU86|SYG1_SCHPO Protein SYG1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.07c PE=3 SV=1 168 780 4.0E-97
sp|P40528|SYG1_YEAST Protein SYG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SYG1 PE=1 SV=1 173 788 1.0E-71
sp|Q8S403|PHO1_ARATH Phosphate transporter PHO1 OS=Arabidopsis thaliana GN=PHO1 PE=2 SV=1 1 784 1.0E-56
sp|Q54MJ9|SPXS3_DICDI SPX and EXS domain-containing protein 3 OS=Dictyostelium discoideum GN=xpr1 PE=3 SV=1 1 772 3.0E-56
sp|Q6R8G0|PHO1A_ARATH Phosphate transporter PHO1 homolog 10 OS=Arabidopsis thaliana GN=PHO1-H10 PE=2 SV=1 170 773 2.0E-54
sp|Q6R8G6|PHO14_ARATH Phosphate transporter PHO1 homolog 4 OS=Arabidopsis thaliana GN=PHO1-H4 PE=2 SV=1 170 776 2.0E-54
sp|Q6R8G7|PHO13_ARATH Phosphate transporter PHO1 homolog 3 OS=Arabidopsis thaliana GN=PHO1;H3 PE=2 SV=2 1 773 1.0E-52
sp|Q9LJW0|PHO19_ARATH Phosphate transporter PHO1 homolog 9 OS=Arabidopsis thaliana GN=PHO1-H9 PE=2 SV=1 1 774 3.0E-52
sp|Q6R8G3|PHO17_ARATH Phosphate transporter PHO1 homolog 7 OS=Arabidopsis thaliana GN=PHO1-H7 PE=2 SV=1 1 783 5.0E-52
sp|Q28CY9|XPR1_XENTR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus tropicalis GN=xpr1 PE=2 SV=1 282 786 7.0E-52
sp|Q657S5|PHO11_ORYSJ Phosphate transporter PHO1-1 OS=Oryza sativa subsp. japonica GN=PHO1-1 PE=2 SV=2 1 773 2.0E-51
sp|Q9TU72|XPR1_NEOVI Xenotropic and polytropic retrovirus receptor 1 OS=Neovison vison GN=XPR1 PE=2 SV=1 282 786 1.0E-50
sp|Q9R032|XPR1_MUSSP Xenotropic and polytropic retrovirus receptor 1 OS=Mus spretus GN=Xpr1 PE=1 SV=1 282 786 2.0E-50
sp|A7XZ53|XPR1_MUSPA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus pahari GN=Xpr1 PE=1 SV=1 282 786 4.0E-50
sp|Q54G02|SPXS5_DICDI SPX and EXS domain-containing protein 5 OS=Dictyostelium discoideum GN=DDB_G0290647 PE=3 SV=2 291 775 4.0E-50
sp|Q9QZ71|XPR1_MUSTR Xenotropic and polytropic retrovirus receptor 1 OS=Mus terricolor GN=Xpr1 PE=1 SV=1 282 786 5.0E-50
sp|Q6R8G2|PHO18_ARATH Phosphate transporter PHO1 homolog 8 OS=Arabidopsis thaliana GN=PHO1-H8 PE=2 SV=1 160 783 1.0E-49
sp|Q9Z0U0|XPR1_MOUSE Xenotropic and polytropic retrovirus receptor 1 OS=Mus musculus GN=Xpr1 PE=1 SV=1 270 786 2.0E-49
sp|Q9QZ70|XPR1_CRIGR Xenotropic and polytropic retrovirus receptor 1 homolog OS=Cricetulus griseus GN=XPR1 PE=2 SV=1 282 786 3.0E-49
sp|Q6DD44|XPR1_XENLA Xenotropic and polytropic retrovirus receptor 1 homolog OS=Xenopus laevis GN=xpr1 PE=2 SV=1 282 771 4.0E-49
sp|Q9UBH6|XPR1_HUMAN Xenotropic and polytropic retrovirus receptor 1 OS=Homo sapiens GN=XPR1 PE=1 SV=1 282 786 6.0E-49
sp|Q9R031|XPR1_MUSMC Xenotropic and polytropic retrovirus receptor 1 homolog OS=Mus musculus castaneus GN=Xpr1 PE=2 SV=1 282 786 6.0E-49
sp|Q6R8G5|PHO15_ARATH Phosphate transporter PHO1 homolog 5 OS=Arabidopsis thaliana GN=PHO1-H5 PE=2 SV=2 285 783 3.0E-48
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 270 786 7.0E-47
sp|Q6R8G8|PHO12_ARATH Phosphate transporter PHO1 homolog 2 OS=Arabidopsis thaliana GN=PHO1-H2 PE=2 SV=2 287 773 2.0E-46
sp|Q6R8G4|PHO16_ARATH Phosphate transporter PHO1 homolog 6 OS=Arabidopsis thaliana GN=PHO1-H6 PE=2 SV=1 170 776 2.0E-46
sp|Q6K991|PHO12_ORYSJ Phosphate transporter PHO1-2 OS=Oryza sativa subsp. japonica GN=PHO1-2 PE=2 SV=1 287 774 2.0E-46
sp|Q651J5|PHO13_ORYSJ Phosphate transporter PHO1-3 OS=Oryza sativa subsp. japonica GN=PHO1-3 PE=2 SV=1 287 773 1.0E-44
sp|Q93ZF5|PHO11_ARATH Phosphate transporter PHO1 homolog 1 OS=Arabidopsis thaliana GN=PHO1-H1 PE=2 SV=1 87 774 3.0E-44
sp|Q54HI2|SPXS4_DICDI SPX and EXS domain-containing protein 4 OS=Dictyostelium discoideum GN=DDB_G0289423 PE=3 SV=1 291 776 1.0E-43
sp|Q55B06|SPXS1_DICDI SPX and EXS domain-containing protein 1 OS=Dictyostelium discoideum GN=DDB_G0271664 PE=3 SV=2 294 776 3.0E-43
sp|Q86HQ3|SPXS2_DICDI SPX and EXS domain-containing protein 2 OS=Dictyostelium discoideum GN=DDB_G0274481 PE=3 SV=1 279 816 2.0E-35
sp|P41771|ERD1_KLULA Protein ERD1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ERD1 PE=3 SV=1 603 759 7.0E-08
sp|Q9UTD8|ERD11_SCHPO Protein ERD1 homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erd1 PE=3 SV=2 484 770 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No
GO:0031224 intrinsic component of membrane No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 392 414 22
2 434 456 22
3 476 498 22
4 508 530 22
5 654 676 22
6 700 722 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 48.98 26.48 71.49
CcL In ants, during behavior modification 30.08 15.75 44.42
CcD In ants, recently dead 36.90 20.07 53.74

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.027104 yes
SC16a CcD 0.231562 no
CcL CcD 0.408917 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1417
MKFAKQLERDAVPEWRVKYLNYKAGKKRIKAVSRALIRTPRSLRDRPSPSPDTGGHDEAHDTDLELPLPAIRPSH
EHTRLLGPSDVVRRGLKRLNGARRRASMSLARTTSQPVAAARPRRGTAGASTAESPSHLRRVWTHASSQLRTSDV
VSQPQFDLVRERARELYDFMDAELEKVETFYRIKEEQAGERLTLLRQQLHEMRSRRLQEMTVSPERHDENGSASQ
PGPVENGLGWVQPIRSKMFPPGPNSKALRAMPQTPRLPTCSADTRRDYIRRPQADDVSYRTAKHKLKLALQELYR
AIELLKAYALLNRTAFRKLNKKWDKAINAQPPLRYVHERVNRAWFVSSDVLEGHAKTVEDLYARYFERGNHKLAA
GKLRSLSPKVTDESASSFFNGILIGSGTVFAAQGLAYGTRLLTDDDAQVRSDTSYLLQLYGGYCMMLLLFALFCL
DCFVWTRSKVNFPFIFEFDQRSHIDWRRLAEFPSFFLFLLGVFLWINFSGYGGEGMYLYYPVLLICITLLVIFFP
APVFAYKSRKWFVYAHWRLLLAGIYPVEFRDFFLGDMYCSLTYSMANVELFFCLYANRWDNPTQCNSSHSRLLGF
FLTLPAIWRLLQCLRRYRDTCNVFPHLVNGGKYAMTIATYVLLSMYRVHGSHTNLGLFIAAATINGIYVSVWDLF
MDFSLLQTQSRHPFLRDILALKRRWPYYGIMVVDPVLRFGWIFFAIFTHDTQHSTIVSFLVSLTEVFRRGLWALF
RVENEHCANVAQYKASRDVPLPYRIEPLMDRASEEEPIPVRRPATEERQQQQGEQRTQQGGAPSGGSSTAVASSP
ASTRRFPDAAIGRSLSQKLASAHTQDFVKRRKPPSLRAPAEGRGLDEAGNEYGEAFEDDDDDDDDDDEGEEEEEA
RVGLAARRRFGHVSEEDLKHGKDRPGS
Coding >Ophio5|1417
ATGAAGTTCGCTAAGCAGCTGGAGCGCGATGCCGTGCCGGAGTGGCGCGTCAAGTATCTCAACTACAAGGCCGGC
AAGAAGCGCATCAAGGCCGTTTCGCGTGCCCTCATACGTACGCCTAGAAGCCTCCGTGACCGTCCGAGTCCCTCC
CCCGATACCGGTGGTCACGATGAAGCCCATGATACCGATTTGGAGCTCCCGCTGCCGGCCATCCGCCCGTCGCAT
GAGCACACTCGACTCCTGGGGCCGTCGGATGTCGTGCGACGCGGATTAAAGCGGCTCAATGGCGCACGTCGACGT
GCTTCCATGTCTCTGGCTAGGACGACGTCTCAGCCCGTGGCTGCGGCACGTCCCAGACGGGGGACAGCCGGCGCA
TCCACGGCCGAATCTCCCTCGCATCTTCGACGCGTTTGGACGCACGCCTCCAGTCAGCTTCGCACATCGGATGTC
GTGTCGCAGCCGCAGTTCGACCTCGTACGGGAACGCGCCCGTGAGCTCTACGACTTCATGGACGCCGAGCTGGAA
AAGGTCGAGACCTTTTACCGCATCAAGGAGGAGCAGGCCGGTGAGCGCCTCACTCTCCTGCGGCAACAGCTGCAC
GAAATGCGCAGCCGGCGTCTGCAGGAGATGACCGTCTCGCCGGAGCGCCACGACGAAAATGGCTCCGCCTCTCAG
CCGGGTCCTGTCGAGAACGGGCTCGGCTGGGTTCAGCCCATCCGGTCCAAGATGTTCCCTCCCGGGCCCAACTCC
AAGGCCTTGCGCGCCATGCCTCAGACGCCACGCCTTCCGACCTGCTCGGCTGATACGCGACGTGACTACATCCGG
CGACCCCAAGCCGACGACGTTTCCTACCGTACCGCCAAGCACAAGCTGAAGCTGGCTCTGCAGGAGCTATATCGT
GCCATCGAACTGCTCAAGGCCTACGCGCTGCTCAACCGCACCGCCTTCCGTAAGCTCAACAAGAAGTGGGACAAG
GCCATCAACGCCCAGCCGCCGCTGCGCTACGTGCACGAGAGGGTCAACCGGGCGTGGTTCGTCAGCAGCGACGTG
CTCGAGGGCCATGCCAAGACAGTCGAGGACCTCTATGCCCGCTACTTTGAGCGCGGCAACCACAAGCTCGCGGCC
GGCAAGCTGCGCAGTCTGTCGCCCAAGGTGACGGACGAGTCGGCCAGCTCCTTCTTCAACGGCATCCTCATCGGC
TCCGGTACCGTCTTCGCCGCTCAGGGGCTCGCGTACGGGACCCGGCTCCTGACCGATGACGATGCCCAAGTGCGG
TCCGATACCAGCTACCTCTTGCAGCTCTACGGCGGATACTGCATGATGTTACTCCTCTTCGCCCTCTTTTGCCTC
GACTGCTTCGTCTGGACCAGGAGCAAGGTCAATTTTCCTTTCATCTTCGAGTTCGACCAGAGGAGCCACATCGAC
TGGCGGCGCCTGGCCGAGTTTCCCAGCTTCTTCCTCTTCCTCCTGGGCGTCTTCCTGTGGATCAATTTCAGCGGA
TACGGAGGCGAGGGCATGTATCTGTACTATCCGGTGCTGTTGATCTGCATCACCCTCCTCGTCATCTTCTTCCCG
GCGCCCGTCTTCGCCTACAAATCCCGGAAATGGTTCGTCTACGCACACTGGCGGCTGCTCCTCGCCGGCATCTAC
CCTGTCGAGTTTCGCGACTTCTTCCTAGGAGACATGTATTGCTCTCTGACCTATTCTATGGCGAACGTCGAGCTC
TTCTTTTGCCTCTACGCCAATCGATGGGATAACCCGACGCAATGCAATTCGAGCCACTCCCGGCTACTGGGCTTC
TTTCTGACGCTGCCGGCCATCTGGCGCCTTCTCCAGTGTCTGCGACGATACCGAGATACGTGCAACGTCTTCCCG
CACCTGGTCAACGGTGGCAAGTATGCCATGACCATCGCCACGTACGTGCTGCTGTCCATGTACCGAGTCCACGGG
TCTCATACCAATCTCGGCCTGTTCATTGCCGCTGCCACCATCAACGGCATCTACGTCTCCGTCTGGGACCTGTTC
ATGGACTTTTCACTCCTACAGACCCAGTCGCGGCACCCCTTCCTGCGCGACATCCTGGCACTGAAGCGGCGCTGG
CCCTACTACGGCATCATGGTGGTGGACCCTGTCCTGCGGTTCGGATGGATATTCTTCGCCATCTTCACCCACGAC
ACGCAGCATTCGACCATTGTGTCCTTCTTGGTGTCTCTCACCGAGGTCTTCCGGCGCGGCCTCTGGGCGCTCTTC
CGGGTCGAGAACGAGCACTGCGCCAACGTGGCCCAGTACAAGGCATCTCGCGACGTGCCCTTGCCATACCGCATC
GAGCCCCTGATGGACCGCGCCAGCGAGGAAGAACCCATTCCCGTGCGACGACCCGCAACGGAGGAGCGGCAACAG
CAGCAGGGCGAACAACGGACGCAGCAAGGCGGCGCCCCGTCTGGCGGCAGCTCCACGGCCGTAGCCAGTTCGCCA
GCGTCGACGAGACGGTTCCCCGATGCGGCCATTGGCAGATCCCTGTCCCAGAAATTGGCCTCGGCGCACACGCAG
GACTTTGTCAAGCGACGCAAGCCGCCATCTCTCCGGGCCCCGGCCGAAGGCAGAGGTCTTGACGAAGCCGGCAAT
GAATACGGCGAGGCTTTTGAAGATGATGATGATGACGATGACGATGACGACGAAGGAGAAGAAGAAGAAGAGGCC
AGGGTCGGGCTTGCGGCGCGTCGTCGCTTCGGACATGTTAGCGAAGAGGATCTCAAGCATGGGAAGGACCGGCCA
GGTTCT
Transcript >Ophio5|1417
ATGAAGTTCGCTAAGCAGCTGGAGCGCGATGCCGTGCCGGAGTGGCGCGTCAAGTATCTCAACTACAAGGCCGGC
AAGAAGCGCATCAAGGCCGTTTCGCGTGCCCTCATACGTACGCCTAGAAGCCTCCGTGACCGTCCGAGTCCCTCC
CCCGATACCGGTGGTCACGATGAAGCCCATGATACCGATTTGGAGCTCCCGCTGCCGGCCATCCGCCCGTCGCAT
GAGCACACTCGACTCCTGGGGCCGTCGGATGTCGTGCGACGCGGATTAAAGCGGCTCAATGGCGCACGTCGACGT
GCTTCCATGTCTCTGGCTAGGACGACGTCTCAGCCCGTGGCTGCGGCACGTCCCAGACGGGGGACAGCCGGCGCA
TCCACGGCCGAATCTCCCTCGCATCTTCGACGCGTTTGGACGCACGCCTCCAGTCAGCTTCGCACATCGGATGTC
GTGTCGCAGCCGCAGTTCGACCTCGTACGGGAACGCGCCCGTGAGCTCTACGACTTCATGGACGCCGAGCTGGAA
AAGGTCGAGACCTTTTACCGCATCAAGGAGGAGCAGGCCGGTGAGCGCCTCACTCTCCTGCGGCAACAGCTGCAC
GAAATGCGCAGCCGGCGTCTGCAGGAGATGACCGTCTCGCCGGAGCGCCACGACGAAAATGGCTCCGCCTCTCAG
CCGGGTCCTGTCGAGAACGGGCTCGGCTGGGTTCAGCCCATCCGGTCCAAGATGTTCCCTCCCGGGCCCAACTCC
AAGGCCTTGCGCGCCATGCCTCAGACGCCACGCCTTCCGACCTGCTCGGCTGATACGCGACGTGACTACATCCGG
CGACCCCAAGCCGACGACGTTTCCTACCGTACCGCCAAGCACAAGCTGAAGCTGGCTCTGCAGGAGCTATATCGT
GCCATCGAACTGCTCAAGGCCTACGCGCTGCTCAACCGCACCGCCTTCCGTAAGCTCAACAAGAAGTGGGACAAG
GCCATCAACGCCCAGCCGCCGCTGCGCTACGTGCACGAGAGGGTCAACCGGGCGTGGTTCGTCAGCAGCGACGTG
CTCGAGGGCCATGCCAAGACAGTCGAGGACCTCTATGCCCGCTACTTTGAGCGCGGCAACCACAAGCTCGCGGCC
GGCAAGCTGCGCAGTCTGTCGCCCAAGGTGACGGACGAGTCGGCCAGCTCCTTCTTCAACGGCATCCTCATCGGC
TCCGGTACCGTCTTCGCCGCTCAGGGGCTCGCGTACGGGACCCGGCTCCTGACCGATGACGATGCCCAAGTGCGG
TCCGATACCAGCTACCTCTTGCAGCTCTACGGCGGATACTGCATGATGTTACTCCTCTTCGCCCTCTTTTGCCTC
GACTGCTTCGTCTGGACCAGGAGCAAGGTCAATTTTCCTTTCATCTTCGAGTTCGACCAGAGGAGCCACATCGAC
TGGCGGCGCCTGGCCGAGTTTCCCAGCTTCTTCCTCTTCCTCCTGGGCGTCTTCCTGTGGATCAATTTCAGCGGA
TACGGAGGCGAGGGCATGTATCTGTACTATCCGGTGCTGTTGATCTGCATCACCCTCCTCGTCATCTTCTTCCCG
GCGCCCGTCTTCGCCTACAAATCCCGGAAATGGTTCGTCTACGCACACTGGCGGCTGCTCCTCGCCGGCATCTAC
CCTGTCGAGTTTCGCGACTTCTTCCTAGGAGACATGTATTGCTCTCTGACCTATTCTATGGCGAACGTCGAGCTC
TTCTTTTGCCTCTACGCCAATCGATGGGATAACCCGACGCAATGCAATTCGAGCCACTCCCGGCTACTGGGCTTC
TTTCTGACGCTGCCGGCCATCTGGCGCCTTCTCCAGTGTCTGCGACGATACCGAGATACGTGCAACGTCTTCCCG
CACCTGGTCAACGGTGGCAAGTATGCCATGACCATCGCCACGTACGTGCTGCTGTCCATGTACCGAGTCCACGGG
TCTCATACCAATCTCGGCCTGTTCATTGCCGCTGCCACCATCAACGGCATCTACGTCTCCGTCTGGGACCTGTTC
ATGGACTTTTCACTCCTACAGACCCAGTCGCGGCACCCCTTCCTGCGCGACATCCTGGCACTGAAGCGGCGCTGG
CCCTACTACGGCATCATGGTGGTGGACCCTGTCCTGCGGTTCGGATGGATATTCTTCGCCATCTTCACCCACGAC
ACGCAGCATTCGACCATTGTGTCCTTCTTGGTGTCTCTCACCGAGGTCTTCCGGCGCGGCCTCTGGGCGCTCTTC
CGGGTCGAGAACGAGCACTGCGCCAACGTGGCCCAGTACAAGGCATCTCGCGACGTGCCCTTGCCATACCGCATC
GAGCCCCTGATGGACCGCGCCAGCGAGGAAGAACCCATTCCCGTGCGACGACCCGCAACGGAGGAGCGGCAACAG
CAGCAGGGCGAACAACGGACGCAGCAAGGCGGCGCCCCGTCTGGCGGCAGCTCCACGGCCGTAGCCAGTTCGCCA
GCGTCGACGAGACGGTTCCCCGATGCGGCCATTGGCAGATCCCTGTCCCAGAAATTGGCCTCGGCGCACACGCAG
GACTTTGTCAAGCGACGCAAGCCGCCATCTCTCCGGGCCCCGGCCGAAGGCAGAGGTCTTGACGAAGCCGGCAAT
GAATACGGCGAGGCTTTTGAAGATGATGATGATGACGATGACGATGACGACGAAGGAGAAGAAGAAGAAGAGGCC
AGGGTCGGGCTTGCGGCGCGTCGTCGCTTCGGACATGTTAGCGAAGAGGATCTCAAGCATGGGAAGGACCGGCCA
GGTTCTTGA
Gene >Ophio5|1417
ATGAAGTTCGCTAAGCAGCTGGAGCGCGATGCCGTGCCGGGTGCGCCACTCTTTCTTTCTCTCTCCCTCCCTCTC
TTCCTCTCTCTCTTCCTCTCTCGGATGGAGGCCTCACCATGGCTGACTGGCTGACTGACTGGCTGACTGACTGAC
TGACTGACTGACTGACTCTCGCAGAGTGGCGCGTCAAGTATCTCAACTACAAGGCCGGCAAGAAGCGCATCAAGG
CCGTTTCGCGTGCCCTCATACGTACGCCTAGAAGCCTCCGTGACCGTCCGAGTCCCTCCCCCGATACCGGTGGTC
ACGATGAAGCCCATGATACCGATTTGGAGCTCCCGCTGCCGGCCATCCGCCCGTCGCATGAGCACACTCGACTCC
TGGGGCCGTCGGATGTCGTGCGACGCGGATTAAAGCGGCTCAATGGCGCACGTCGACGTGCTTCCATGTCTCTGG
CTAGGACGACGTCTCAGCCCGTGGCTGCGGCACGTCCCAGACGGGGGACAGCCGGCGCATCCACGGCCGAATCTC
CCTCGCATCTTCGACGCGTTTGGACGCACGCCTCCAGTCAGCTTCGCACATCGGATGTCGTGTCGCAGCCGCAGT
TCGACCTCGTACGGGAACGCGCCCGTGAGCTCTACGACTTCATGGACGCCGAGCTGGAAAAGGTCGAGACCTTTT
ACCGCATCAAGGAGGAGCAGGCCGGTGAGCGCCTCACTCTCCTGCGGCAACAGCTGCACGAAATGCGCAGCCGGC
GTCTGCAGGAGATGACCGTCTCGCCGGAGCGCCACGACGAAAATGGCTCCGCCTCTCAGCCGGGTCCTGTCGAGA
ACGGGCTCGGCTGGGTTCAGCCCATCCGGTCCAAGATGTTCCCTCCCGGGCCCAACTCCAAGGCCTTGCGCGCCA
TGCCTCAGACGCCACGCCTTCCGACCTGCTCGGCTGATACGCGACGTGACTACATCCGGCGACCCCAAGCCGACG
ACGTTTCCTACCGTACCGCCAAGCACAAGCTGAAGCTGGCTCTGCAGGAGCTATATCGTGCCATCGAACTGCTCA
AGGCCTACGCGCTGCTCAACCGCACCGCCTTCCGTAAGCTCAACAAGAAGTGGGACAAGGCCATCAACGCCCAGC
CGCCGCTGCGCTACGTGCACGAGAGGGTCAACCGGGCGTGGTTCGTCAGCAGCGACGTGCTCGAGGGCCATGCCA
AGACAGTCGAGGACCTCTATGCCCGCTACTTTGAGCGCGGCAACCACAAGCTCGCGGCCGGCAAGCTGCGCAGTC
TGTCGCCCAAGGTGACGGACGAGTCGGCCAGCTCCTTCTTCAACGGCATCCTCATCGGCTCCGGTACCGTCTTCG
CCGCTCAGGGGCTCGCGTACGGGACCCGGCTCCTGACCGATGACGATGCCCAAGTGCGGTCCGATACCAGCTACC
TCTTGCAGCTCTACGGCGGATACTGCATGATGTTACTCCTCTTCGCCCTCTTTTGCCTCGACTGCTTCGTCTGGA
CCAGGAGCAAGGTCAATTTTCCTTTCATCTTCGAGTTCGACCAGAGGAGCCACATCGACTGGCGGCGCCTGGCCG
AGTTTCCCAGCTTCTTCCTCTTCCTCCTGGGCGTCTTCCTGTGGATCAATTTCAGCGGATACGGAGGCGAGGGCA
TGTATCTGTACTATCCGGTGCTGTTGATCTGCATCACCCTCCTCGTCATCTTCTTCCCGGCGCCCGTCTTCGCCT
ACAAATCCCGGAAATGGTTCGTCTACGCACACGTGAGGCTCCCCGTCCCTCCCGCGCCGCCGCGGCCGGCTTCAA
GGTACTGACTGAAAGCTCTGCAGTGGCGGCTGCTCCTCGCCGGCATCTACCCTGTCGAGTTTCGCGACTTCTTCC
TAGGAGACATGTATTGCTCTCTGACCTATTCTATGGCGGTGAGACGTCGTCTACGGCCTCGTCTCGTCCCATCCG
GCTAACGCCCTGCAGAACGTCGAGCTCTTCTTTTGCCTCTACGCCAATCGATGGGATAACCCGACGCAATGCAAT
TCGAGCCACTCCCGGCTACTGGGCTTCTTTCTGACGCTGCCGGCCATCTGGCGCCTTCTCCAGTGTCTGCGACGA
TACCGAGATACGTGCAACGTCTTCCCGCACCTGGTCAACGGTGGCAAGTATGCCATGACCATCGCCACGTACGTG
CTGCTGTCCATGTACCGAGTCCACGGGTCTCATACCAATCTCGGCCTGTTCATTGCCGCTGCCACCATCAACGGC
ATCTACGTCTGTGAGTTTCTCATGCCTTGACGGGCGCGGCCGATGCTGACGGCCTCGACCTAGCCGTCTGGGACC
TGTTCATGGACTTTTCACTCCTACAGACCCAGTCGCGGCACCCCTTCCTGCGCGACATCCTGGCACTGAAGCGGC
GCTGGCCCTACTACGGCATCATGGTGGTGGACCCTGTCCTGCGGTTCGGATGGATATTCTTCGCCATCTTCACCC
ACGACACGCAGCATTCGACCATTGTGTCCTTCTTGGTGTCTCTCACCGAGGTCTTCCGGCGCGGCCTCTGGGCGC
TCTTCCGGGTCGAGAACGAGCACTGCGCCAACGTGGCCCAGTACAAGGCATCTCGCGACGTGCCCTTGCCATACC
GCATCGAGCCCCTGATGGACCGCGCCAGCGAGGAAGAACCCATTCCCGTGCGACGACCCGCAACGGAGGAGCGGC
AACAGCAGCAGGGCGAACAACGGACGCAGCAAGGCGGCGCCCCGTCTGGCGGCAGCTCCACGGCCGTAGCCAGTT
CGCCAGCGTCGACGAGACGGTTCCCCGATGCGGCCATTGGCAGATCCCTGTCCCAGAAATTGGCCTCGGCGCACA
CGCAGGACTTTGTCAAGCGACGCAAGCCGCCATCTCTCCGGGCCCCGGCCGAAGGCAGAGGTCTTGACGAAGCCG
GCAATGAATACGGCGAGGCTTTTGAAGATGATGATGATGACGATGACGATGACGACGAAGGAGAAGAAGAAGAAG
AGGCCAGGGTCGGGCTTGCGGCGCGTCGTCGCTTCGGACATGTTAGCGAAGAGGATCTCAAGCATGGGAAGGACC
GGCCAGGTTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail