Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1413
Gene name
Locationscaffold_149:13051..14921
Strand+
Gene length (bp)1870
Transcript length (bp)1809
Coding sequence length (bp)1806
Protein length (aa) 602

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13520 AA_permease_2 Amino acid permease 5.3E-58 112 552
PF00324 AA_permease Amino acid permease 1.3E-19 120 437

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 91 580 3.0E-79
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 104 574 2.0E-76
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 108 570 6.0E-74
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 104 576 4.0E-73
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 105 592 2.0E-72
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BGK6|YLAT2_MOUSE Y+L amino acid transporter 2 OS=Mus musculus GN=Slc7a6 PE=1 SV=1 91 580 3.0E-79
sp|Q92536|YLAT2_HUMAN Y+L amino acid transporter 2 OS=Homo sapiens GN=SLC7A6 PE=1 SV=3 104 574 2.0E-76
sp|P82251|BAT1_HUMAN b(0,+)-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A9 PE=1 SV=1 108 570 6.0E-74
sp|Q9N1R6|BAT1_RABIT b(0,+)-type amino acid transporter 1 OS=Oryctolagus cuniculus GN=SLC7A9 PE=1 SV=1 104 576 4.0E-73
sp|Q59I64|YLAT2_DANRE Y+L amino acid transporter 2 OS=Danio rerio GN=slc7a6 PE=2 SV=1 105 592 2.0E-72
sp|Q9QXA6|BAT1_MOUSE b(0,+)-type amino acid transporter 1 OS=Mus musculus GN=Slc7a9 PE=1 SV=1 104 576 9.0E-72
sp|Q28I80|YLAT2_XENTR Y+L amino acid transporter 2 OS=Xenopus tropicalis GN=slc7a6 PE=2 SV=1 104 574 9.0E-72
sp|Q9R0S5|YLAT1_RAT Y+L amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a7 PE=1 SV=1 100 583 3.0E-71
sp|A1L3M3|YLAT2_XENLA Y+L amino acid transporter 2 OS=Xenopus laevis GN=slc7a6 PE=2 SV=1 77 597 7.0E-71
sp|Q9UM01|YLAT1_HUMAN Y+L amino acid transporter 1 OS=Homo sapiens GN=SLC7A7 PE=1 SV=2 92 591 1.0E-69
sp|Q01650|LAT1_HUMAN Large neutral amino acids transporter small subunit 1 OS=Homo sapiens GN=SLC7A5 PE=1 SV=2 99 578 1.0E-69
sp|Q9Z1K8|YLAT1_MOUSE Y+L amino acid transporter 1 OS=Mus musculus GN=Slc7a7 PE=1 SV=1 91 573 1.0E-69
sp|Q9WTR6|XCT_MOUSE Cystine/glutamate transporter OS=Mus musculus GN=Slc7a11 PE=1 SV=1 77 580 2.0E-68
sp|P82252|BAT1_RAT b(0,+)-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a9 PE=1 SV=1 104 578 2.0E-67
sp|Q7YQK4|LAT1_RABIT Large neutral amino acids transporter small subunit 1 OS=Oryctolagus cuniculus GN=SLC7A5 PE=1 SV=1 90 578 9.0E-67
sp|Q9Z127|LAT1_MOUSE Large neutral amino acids transporter small subunit 1 OS=Mus musculus GN=Slc7a5 PE=1 SV=2 100 578 6.0E-66
sp|Q63016|LAT1_RAT Large neutral amino acids transporter small subunit 1 OS=Rattus norvegicus GN=Slc7a5 PE=1 SV=2 100 578 6.0E-66
sp|Q5RAE3|LAT2_PONAB Large neutral amino acids transporter small subunit 2 OS=Pongo abelii GN=SLC7A8 PE=2 SV=2 57 578 4.0E-65
sp|Q9UHI5|LAT2_HUMAN Large neutral amino acids transporter small subunit 2 OS=Homo sapiens GN=SLC7A8 PE=1 SV=1 57 578 4.0E-65
sp|Q9QXW9|LAT2_MOUSE Large neutral amino acids transporter small subunit 2 OS=Mus musculus GN=Slc7a8 PE=1 SV=1 92 578 7.0E-64
sp|Q9WVR6|LAT2_RAT Large neutral amino acids transporter small subunit 2 OS=Rattus norvegicus GN=Slc7a8 PE=1 SV=1 92 588 1.0E-63
sp|Q9N1Q4|LAT2_RABIT Large neutral amino acids transporter small subunit 2 OS=Oryctolagus cuniculus GN=SLC7A8 PE=1 SV=1 99 578 3.0E-63
sp|Q9UPY5|XCT_HUMAN Cystine/glutamate transporter OS=Homo sapiens GN=SLC7A11 PE=1 SV=1 77 580 4.0E-62
sp|Q5RAG7|XCT_PONAB Cystine/glutamate transporter OS=Pongo abelii GN=SLC7A11 PE=2 SV=1 77 580 5.0E-62
sp|P63116|AAA1_RAT Asc-type amino acid transporter 1 OS=Rattus norvegicus GN=Slc7a10 PE=2 SV=1 132 588 6.0E-57
sp|P63115|AAA1_MOUSE Asc-type amino acid transporter 1 OS=Mus musculus GN=Slc7a10 PE=1 SV=1 132 588 6.0E-57
sp|Q9NS82|AAA1_HUMAN Asc-type amino acid transporter 1 OS=Homo sapiens GN=SLC7A10 PE=2 SV=1 88 588 3.0E-49
sp|Q5RKI7|S7A13_RAT Solute carrier family 7 member 13 OS=Rattus norvegicus GN=Slc7a13 PE=2 SV=1 108 536 7.0E-38
sp|Q91WN3|S7A13_MOUSE Solute carrier family 7 member 13 OS=Mus musculus GN=Slc7a13 PE=1 SV=1 101 553 2.0E-36
sp|P50276|MUP1_YEAST High-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP1 PE=1 SV=1 106 430 3.0E-30
sp|Q8TCU3|S7A13_HUMAN Solute carrier family 7 member 13 OS=Homo sapiens GN=SLC7A13 PE=2 SV=1 102 533 2.0E-29
sp|O34739|STET_BACSU Serine/threonine exchanger SteT OS=Bacillus subtilis (strain 168) GN=steT PE=1 SV=1 108 569 5.0E-26
sp|Q8MH63|LAT1N_HUMAN Putative L-type amino acid transporter 1-like protein MLAS OS=Homo sapiens GN=SLC7A5P1 PE=5 SV=1 99 219 2.0E-21
sp|P38734|MUP3_YEAST Low-affinity methionine permease OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MUP3 PE=1 SV=1 109 552 4.0E-21
sp|Q9GIP4|LAT1L_HUMAN Putative L-type amino acid transporter 1-like protein IMAA OS=Homo sapiens GN=SLC7A5P2 PE=5 SV=2 99 219 1.0E-17
sp|Q84MA5|CAAT1_ARATH Cationic amino acid transporter 1 OS=Arabidopsis thaliana GN=CAT1 PE=1 SV=1 106 386 9.0E-14
sp|P60066|ADIC_SALTY Arginine/agmatine antiporter OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=adiC PE=1 SV=1 119 443 1.0E-13
sp|P60065|ADIC_SALTI Arginine/agmatine antiporter OS=Salmonella typhi GN=adiC PE=3 SV=1 119 443 1.0E-13
sp|P60064|ADIC_SHIFL Arginine/agmatine antiporter OS=Shigella flexneri GN=adiC PE=3 SV=1 119 443 8.0E-13
sp|P60061|ADIC_ECOLI Arginine/agmatine antiporter OS=Escherichia coli (strain K12) GN=adiC PE=1 SV=1 119 443 8.0E-13
sp|P60062|ADIC_ECOL6 Arginine/agmatine antiporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=adiC PE=3 SV=1 119 443 8.0E-13
sp|P60063|ADIC_ECO57 Arginine/agmatine antiporter OS=Escherichia coli O157:H7 GN=adiC PE=1 SV=1 119 443 8.0E-13
sp|P45539|FRLA_ECOLI Putative fructoselysine transporter FrlA OS=Escherichia coli (strain K12) GN=frlA PE=3 SV=2 103 569 1.0E-12
sp|Q8X845|FRLA_ECO57 Putative fructoselysine transporter FrlA OS=Escherichia coli O157:H7 GN=frlA PE=3 SV=2 103 569 2.0E-12
sp|Q8ZGS9|ADIC_YERPE Arginine/agmatine antiporter OS=Yersinia pestis GN=adiC PE=3 SV=1 119 443 4.0E-11
sp|Q9LZ20|CAAT6_ARATH Cationic amino acid transporter 6, chloroplastic OS=Arabidopsis thaliana GN=CAT6 PE=2 SV=1 106 549 2.0E-09
sp|O34560|YECA_BACSU Uncharacterized amino acid permease YecA OS=Bacillus subtilis (strain 168) GN=yecA PE=3 SV=2 106 448 6.0E-09
sp|Q9SQZ0|CAAT7_ARATH Cationic amino acid transporter 7, chloroplastic OS=Arabidopsis thaliana GN=CAT7 PE=3 SV=1 106 442 1.0E-08
sp|Q45577|YBEC_BACSU Probable amino acid-proton symporter YbeC OS=Bacillus subtilis (strain 168) GN=ybeC PE=3 SV=3 106 582 2.0E-08
sp|O64759|CAAT5_ARATH Cationic amino acid transporter 5 OS=Arabidopsis thaliana GN=CAT5 PE=1 SV=1 106 442 3.0E-08
sp|Q8W4K3|CAAT4_ARATH Cationic amino acid transporter 4, vacuolar OS=Arabidopsis thaliana GN=CAT4 PE=2 SV=1 95 440 4.0E-08
sp|O07002|ASPP_BACSU Aspartate-proton symporter OS=Bacillus subtilis (strain 168) GN=yveA PE=1 SV=1 108 442 7.0E-08
sp|P25737|LYSP_ECOLI Lysine-specific permease OS=Escherichia coli (strain K12) GN=lysP PE=1 SV=5 121 439 8.0E-08
sp|P44768|POTE_HAEIN Putrescine-ornithine antiporter OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=potE PE=3 SV=1 124 562 1.0E-07
sp|O32204|ARCD_BACSU Putative arginine/ornithine antiporter OS=Bacillus subtilis (strain 168) GN=yvsH PE=3 SV=1 105 435 3.0E-07
sp|Q797A7|YFNA_BACSU Uncharacterized amino acid permease YfnA OS=Bacillus subtilis (strain 168) GN=yfnA PE=3 SV=1 98 535 4.0E-07
sp|P9WQM5|Y1979_MYCTU Uncharacterized transporter Rv1979c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1979c PE=1 SV=1 108 435 9.0E-07
sp|P9WQM4|Y1979_MYCTO Uncharacterized transporter MT2031 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2031 PE=3 SV=1 108 435 9.0E-07
sp|P0AAE0|CYCA_ECOLI D-serine/D-alanine/glycine transporter OS=Escherichia coli (strain K12) GN=cycA PE=1 SV=1 238 436 9.0E-07
sp|P0AAE1|CYCA_ECO57 D-serine/D-alanine/glycine transporter OS=Escherichia coli O157:H7 GN=cycA PE=3 SV=1 238 436 9.0E-07
sp|Q7TZ67|Y2001_MYCBO Uncharacterized transporter Mb2001c OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2001c PE=3 SV=1 108 435 9.0E-07
sp|O34618|YTNA_BACSU Uncharacterized amino acid permease YtnA OS=Bacillus subtilis (strain 168) GN=ytnA PE=3 SV=1 106 439 2.0E-06
sp|Q58026|Y609_METJA Uncharacterized protein MJ0609 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0609 PE=1 SV=1 107 435 2.0E-06
sp|Q9ASS7|CAAT2_ARATH Cationic amino acid transporter 2, vacuolar OS=Arabidopsis thaliana GN=CAT2 PE=2 SV=1 101 440 2.0E-06
sp|P96704|YDGF_BACSU Uncharacterized transporter YdgF OS=Bacillus subtilis (strain 168) GN=ydgF PE=3 SV=1 248 436 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

Domain # Start End Length
1 111 133 22
2 148 170 22
3 191 213 22
4 228 250 22
5 262 284 22
6 346 368 22
7 388 410 22
8 466 488 22
9 493 515 22
10 530 549 19
11 556 575 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1413
MPAPSGAQTRDSLELASLASSSVAHDGEPSSRPSMASSRRLSFTEEDPLDEDNPAGGARHRSYSVSSAFDFAGNL
FPLSSTAGTGGYAPIGAPTSAGLAGAGGSLEKHKTLTYFNGLSLIVGLIIGSGIFSSPSQVSSQVGSPGAALVVW
VVAGFLAWTGAASYAELGGAIPLNGGSQVYLAKTFGELAGFLFTGVAVLVLKPGSAAIIAIIMGEYLVRAAIGAE
VETVNPWVYKSVALAGIALVTLLNCVSTRVGTRVNDFLMLLKFVALLAVTVMGLFVAVTGHTLQGDVDVVWKTHD
WFTGTTSDLSKWAVALYAGLWAFDGWDNTNYVVGEFRNPSRDLPRVMHTAMPLVILCYALANVAYFLVLPIEVIN
GSNTVAVKFGARVLGRAGALAMALTVSASCFGALNSSTFTAGRLVYVAAKEGYIPAVFGRLGAGTGTASTRRPGW
CWRAVHSCLGDDDVGLFYTPMYALALNGLLTAGYCVVGEFATLVTFYGVAGYTFYFLTVLGLILLRVREPTLERP
YKTWITTPFVFCCVSLFLLSGAVFAKPLQTLVVVTFVLAGVPVYLWRIWGRDRTPAVRPKRESGESKGGSRWWRF
WR
Coding >Ophio5|1413
ATGCCTGCCCCGTCCGGCGCCCAGACGCGCGACTCGCTCGAGCTCGCGTCTCTGGCCAGCTCTAGTGTCGCTCAC
GATGGGGAGCCGTCGTCGCGCCCAAGCATGGCCTCTTCTCGCAGGCTGTCCTTTACCGAGGAGGATCCGTTAGAC
GAGGATAATCCGGCCGGGGGTGCGCGTCATCGGTCCTATTCCGTCTCGTCTGCTTTCGACTTTGCCGGCAACTTG
TTTCCTCTCAGCTCGACTGCGGGGACGGGCGGATACGCGCCCATCGGCGCGCCTACTTCGGCCGGGCTTGCGGGC
GCTGGCGGGTCGCTGGAGAAACACAAGACGCTGACGTATTTCAACGGCCTGTCGCTCATTGTCGGCCTCATCATT
GGTTCCGGAATCTTCTCGTCGCCCAGTCAGGTCAGCTCTCAGGTCGGGTCACCCGGCGCCGCGTTGGTGGTATGG
GTGGTGGCCGGTTTCCTGGCCTGGACGGGGGCCGCCTCCTACGCCGAACTCGGAGGCGCCATTCCCCTCAACGGC
GGGTCGCAGGTCTACCTGGCCAAGACGTTTGGCGAGCTGGCCGGCTTTCTCTTCACCGGGGTGGCGGTGCTGGTG
CTCAAGCCAGGCAGCGCGGCCATCATTGCTATCATCATGGGCGAATATCTGGTGCGGGCTGCCATTGGCGCCGAA
GTCGAGACGGTCAACCCATGGGTCTACAAGTCGGTGGCGCTGGCGGGCATTGCCCTGGTGACGCTGCTCAACTGC
GTATCGACTCGGGTCGGCACGCGCGTCAACGACTTTCTCATGCTGCTCAAGTTTGTCGCCCTCCTTGCCGTCACC
GTCATGGGCCTCTTCGTCGCCGTTACGGGTCACACCTTGCAGGGCGATGTGGACGTGGTGTGGAAGACGCACGAC
TGGTTCACTGGCACGACTTCCGACTTGTCAAAATGGGCCGTAGCGCTGTATGCAGGGCTATGGGCTTTTGATGGA
TGGGACAATACCAATTACGTCGTCGGCGAGTTCCGCAACCCAAGCCGCGACTTGCCGCGCGTCATGCATACTGCC
ATGCCGCTGGTGATTCTCTGCTACGCACTGGCCAACGTGGCCTACTTCTTGGTGCTGCCGATCGAGGTGATCAAC
GGGTCCAACACGGTGGCCGTTAAGTTCGGGGCGCGGGTGCTGGGCCGGGCCGGGGCACTGGCCATGGCGCTGACG
GTGAGCGCCAGCTGCTTCGGCGCCCTCAACTCGTCGACCTTTACAGCCGGACGGCTGGTCTACGTCGCCGCGAAA
GAGGGCTACATCCCTGCCGTCTTCGGACGGCTCGGGGCCGGCACCGGCACGGCTTCGACGCGAAGACCCGGCTGG
TGTTGGCGGGCGGTGCACAGCTGTCTCGGCGACGACGACGTGGGCCTCTTTTACACGCCCATGTACGCGCTGGCG
CTCAACGGCCTGCTGACGGCCGGCTACTGTGTGGTGGGCGAGTTCGCGACGTTGGTGACGTTTTACGGCGTGGCC
GGCTACACGTTTTACTTTTTGACTGTCCTGGGACTGATCCTGCTTCGGGTTCGGGAGCCGACGCTGGAACGGCCT
TACAAGACGTGGATCACGACGCCTTTTGTTTTTTGCTGTGTGAGCCTCTTCCTCCTGAGCGGGGCCGTCTTCGCC
AAACCATTGCAGACGCTGGTGGTTGTGACGTTTGTCTTGGCCGGCGTGCCCGTCTACCTGTGGCGGATATGGGGC
CGGGACCGGACCCCTGCGGTGCGTCCTAAGAGGGAGTCGGGGGAGAGCAAGGGGGGAAGCCGGTGGTGGCGATTT
TGGCGG
Transcript >Ophio5|1413
ATGCCTGCCCCGTCCGGCGCCCAGACGCGCGACTCGCTCGAGCTCGCGTCTCTGGCCAGCTCTAGTGTCGCTCAC
GATGGGGAGCCGTCGTCGCGCCCAAGCATGGCCTCTTCTCGCAGGCTGTCCTTTACCGAGGAGGATCCGTTAGAC
GAGGATAATCCGGCCGGGGGTGCGCGTCATCGGTCCTATTCCGTCTCGTCTGCTTTCGACTTTGCCGGCAACTTG
TTTCCTCTCAGCTCGACTGCGGGGACGGGCGGATACGCGCCCATCGGCGCGCCTACTTCGGCCGGGCTTGCGGGC
GCTGGCGGGTCGCTGGAGAAACACAAGACGCTGACGTATTTCAACGGCCTGTCGCTCATTGTCGGCCTCATCATT
GGTTCCGGAATCTTCTCGTCGCCCAGTCAGGTCAGCTCTCAGGTCGGGTCACCCGGCGCCGCGTTGGTGGTATGG
GTGGTGGCCGGTTTCCTGGCCTGGACGGGGGCCGCCTCCTACGCCGAACTCGGAGGCGCCATTCCCCTCAACGGC
GGGTCGCAGGTCTACCTGGCCAAGACGTTTGGCGAGCTGGCCGGCTTTCTCTTCACCGGGGTGGCGGTGCTGGTG
CTCAAGCCAGGCAGCGCGGCCATCATTGCTATCATCATGGGCGAATATCTGGTGCGGGCTGCCATTGGCGCCGAA
GTCGAGACGGTCAACCCATGGGTCTACAAGTCGGTGGCGCTGGCGGGCATTGCCCTGGTGACGCTGCTCAACTGC
GTATCGACTCGGGTCGGCACGCGCGTCAACGACTTTCTCATGCTGCTCAAGTTTGTCGCCCTCCTTGCCGTCACC
GTCATGGGCCTCTTCGTCGCCGTTACGGGTCACACCTTGCAGGGCGATGTGGACGTGGTGTGGAAGACGCACGAC
TGGTTCACTGGCACGACTTCCGACTTGTCAAAATGGGCCGTAGCGCTGTATGCAGGGCTATGGGCTTTTGATGGA
TGGGACAATACCAATTACGTCGTCGGCGAGTTCCGCAACCCAAGCCGCGACTTGCCGCGCGTCATGCATACTGCC
ATGCCGCTGGTGATTCTCTGCTACGCACTGGCCAACGTGGCCTACTTCTTGGTGCTGCCGATCGAGGTGATCAAC
GGGTCCAACACGGTGGCCGTTAAGTTCGGGGCGCGGGTGCTGGGCCGGGCCGGGGCACTGGCCATGGCGCTGACG
GTGAGCGCCAGCTGCTTCGGCGCCCTCAACTCGTCGACCTTTACAGCCGGACGGCTGGTCTACGTCGCCGCGAAA
GAGGGCTACATCCCTGCCGTCTTCGGACGGCTCGGGGCCGGCACCGGCACGGCTTCGACGCGAAGACCCGGCTGG
TGTTGGCGGGCGGTGCACAGCTGTCTCGGCGACGACGACGTGGGCCTCTTTTACACGCCCATGTACGCGCTGGCG
CTCAACGGCCTGCTGACGGCCGGCTACTGTGTGGTGGGCGAGTTCGCGACGTTGGTGACGTTTTACGGCGTGGCC
GGCTACACGTTTTACTTTTTGACTGTCCTGGGACTGATCCTGCTTCGGGTTCGGGAGCCGACGCTGGAACGGCCT
TACAAGACGTGGATCACGACGCCTTTTGTTTTTTGCTGTGTGAGCCTCTTCCTCCTGAGCGGGGCCGTCTTCGCC
AAACCATTGCAGACGCTGGTGGTTGTGACGTTTGTCTTGGCCGGCGTGCCCGTCTACCTGTGGCGGATATGGGGC
CGGGACCGGACCCCTGCGGTGCGTCCTAAGAGGGAGTCGGGGGAGAGCAAGGGGGGAAGCCGGTGGTGGCGATTT
TGGCGGTGA
Gene >Ophio5|1413
ATGCCTGCCCCGTCCGGCGCCCAGACGCGCGACTCGCTCGAGCTCGCGTCTCTGGCCAGCTCTAGTGTCGCTCAC
GATGGGGAGCCGTCGTCGCGCCCAAGCATGGCCTCTTCTCGCAGGCTGTCCTTTACCGAGGAGGATCCGTTAGAC
GAGGATAATCCGGCCGGGGGTGCGCGTCATCGGTCCTATTCCGTCTCGTCTGCTTTCGACTTTGCCGGCAACTTG
TTTCCTCTCAGCTCGACTGCGGGGACGGGCGGATACGCGCCCATCGGCGCGCCTACTTCGGCCGGGCTTGCGGGC
GCTGGCGGGTCGCTGGAGAAACACAAGACGCTGACGTATTTCAACGGCCTGTCGCTCATTGTCGGCCTCATCATT
GGTTCCGGAATCTTCTCGTCGCCCAGTCAGGTCAGCTCTCAGGTCGGGTCACCCGGCGCCGCGTTGGTGGTATGG
GTGGTGGCCGGTTTCCTGGCCTGGACGGGGGCCGCCTCCTACGCCGAACTCGGAGGCGCCATTCCCCTCAACGGC
GGGTCGCAGGTCTACCTGGCCAAGACGTTTGGCGAGCTGGCCGGCTTTCTCTTCACCGGGGTGGCGGTGCTGGTG
CTCAAGCCAGGCAGCGCGGCCATCATTGCTATCATCATGGGCGAATATCTGGTGCGGGCTGCCATTGGCGCCGAA
GTCGAGACGGTCAACCCATGGGTCTACAAGTCGGTGGCGCTGGCGGGCATTGCCCTGGTGACGCTGCTCAACTGC
GTATCGACTCGGGTCGGCACGCGCGTCAACGACTTTCTCATGCTGCTCAAGTTTGTCGCCCTCCTTGCCGTCACC
GTCATGGGCCTCTTCGTCGCCGTTACGGGTCACACCTTGCAGGGCGATGTGGACGTGGTGTGGAAGACGCACGAC
TGGTTCACTGGCACGACTTCCGACTTGTCAAAATGGGCCGTAGCGCTGTATGCAGGGCTATGGGCTTTTGATGGA
TGGGACAATGTGAGTTGAGAAGTCTTTCTCCCTGTCTTGACCCTGAACATTGGCTGACGGGCTTGAGCAGACCAA
TTACGTCGTCGGCGAGTTCCGCAACCCAAGCCGCGACTTGCCGCGCGTCATGCATACTGCCATGCCGCTGGTGAT
TCTCTGCTACGCACTGGCCAACGTGGCCTACTTCTTGGTGCTGCCGATCGAGGTGATCAACGGGTCCAACACGGT
GGCCGTTAAGTTCGGGGCGCGGGTGCTGGGCCGGGCCGGGGCACTGGCCATGGCGCTGACGGTGAGCGCCAGCTG
CTTCGGCGCCCTCAACTCGTCGACCTTTACAGCCGGACGGCTGGTCTACGTCGCCGCGAAAGAGGGCTACATCCC
TGCCGTCTTCGGACGGCTCGGGGCCGGCACCGGCACGGCTTCGACGCGAAGACCCGGCTGGTGTTGGCGGGCGGT
GCACAGCTGTCTCGGCGACGACGACGTGGGCCTCTTTTACACGCCCATGTACGCGCTGGCGCTCAACGGCCTGCT
GACGGCCGGCTACTGTGTGGTGGGCGAGTTCGCGACGTTGGTGACGTTTTACGGCGTGGCCGGCTACACGTTTTA
CTTTTTGACTGTCCTGGGACTGATCCTGCTTCGGGTTCGGGAGCCGACGCTGGAACGGCCTTACAAGACGTGGAT
CACGACGCCTTTTGTTTTTTGCTGTGTGAGCCTCTTCCTCCTGAGCGGGGCCGTCTTCGCCAAACCATTGCAGAC
GCTGGTGGTTGTGACGTTTGTCTTGGCCGGCGTGCCCGTCTACCTGTGGCGGATATGGGGCCGGGACCGGACCCC
TGCGGTGCGTCCTAAGAGGGAGTCGGGGGAGAGCAAGGGGGGAAGCCGGTGGTGGCGATTTTGGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail