Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1412
Gene name
Locationscaffold_149:12077..12526
Strand-
Gene length (bp)449
Transcript length (bp)390
Coding sequence length (bp)387
Protein length (aa) 129

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08555 FAM32A FAM32A 1.3E-10 6 88

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q92363|YEJL_SCHPO Uncharacterized protein C31G5.21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=N118 PE=4 SV=1 64 129 9.0E-11

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2662 0.8906 0.0143 0.037 0.0671 0.003 0.0812 0.0175 0.0973 0.0059

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1831
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5588
Ophiocordyceps australis map64 (Brazil) OphauB2|1030
Ophiocordyceps camponoti-floridani Ophcf2|06763
Ophiocordyceps camponoti-rufipedis Ophun1|5759
Ophiocordyceps kimflemingae Ophio5|1412 (this protein)
Ophiocordyceps subramaniannii Hirsu2|182

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1412
MPSDEYTAVGGSGALRLKGAKVQKRKKRKTKDKDQTALAEKLSRPETDDAEADCARPDAGADNDDDTLAQKTESE
RRYEEAKKKRILQMTHASGARPELLKTHKERVEELNTYLSKLSEHHDMPKIGPG
Coding >Ophio5|1412
ATGCCCTCGGACGAATACACTGCCGTCGGCGGCTCCGGTGCCCTCCGACTAAAAGGCGCCAAAGTCCAGAAGCGC
AAGAAGAGGAAGACTAAAGACAAAGACCAGACCGCCCTCGCCGAAAAGCTCTCCCGGCCGGAAACCGACGACGCC
GAAGCCGATTGCGCCCGACCGGACGCCGGAGCCGACAATGATGATGACACTCTGGCGCAAAAGACAGAGTCGGAG
CGTCGCTACGAAGAGGCCAAGAAGAAGCGCATCCTTCAGATGACACACGCTTCCGGCGCCAGGCCTGAGCTACTC
AAGACGCACAAGGAGCGCGTCGAGGAGCTGAACACGTACCTGTCCAAGCTCAGCGAACATCATGATATGCCCAAG
ATCGGACCCGGC
Transcript >Ophio5|1412
ATGCCCTCGGACGAATACACTGCCGTCGGCGGCTCCGGTGCCCTCCGACTAAAAGGCGCCAAAGTCCAGAAGCGC
AAGAAGAGGAAGACTAAAGACAAAGACCAGACCGCCCTCGCCGAAAAGCTCTCCCGGCCGGAAACCGACGACGCC
GAAGCCGATTGCGCCCGACCGGACGCCGGAGCCGACAATGATGATGACACTCTGGCGCAAAAGACAGAGTCGGAG
CGTCGCTACGAAGAGGCCAAGAAGAAGCGCATCCTTCAGATGACACACGCTTCCGGCGCCAGGCCTGAGCTACTC
AAGACGCACAAGGAGCGCGTCGAGGAGCTGAACACGTACCTGTCCAAGCTCAGCGAACATCATGATATGCCCAAG
ATCGGACCCGGCTGA
Gene >Ophio5|1412
ATGCCCTCGGACGAATACACTGCCGTCGGCGGCTCCGGTGCCCTCCGACTAAAAGGCGCCAAAGTCCAGAAGCGC
AAGAAGAGGAAGACTAAAGACAAAGACCAGACCGCCCTCGCCGAAAAGCTCTCCCGGCCGGAAACCGACGACGCC
GAAGCCGATTGCGCCCGACCGGACGCCGGAGCCGACAATGATGATGACACTCTGGCGCAAAAGACAGAGTCGGAG
CGTCGCTACGAAGAGGCCAAGAAGAAGCGCGTGGGTCCCTCCTTTCCCTCCCTTTCGCCCGTCTATTCGTCTGAT
CCGCCCGCGTCTAGATCCTTCAGATGACACACGCTTCCGGCGCCAGGCCTGAGCTACTCAAGACGCACAAGGAGC
GCGTCGAGGAGCTGAACACGTACCTGTCCAAGCTCAGCGAACATCATGATATGCCCAAGATCGGACCCGGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail