Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1411
Gene name
Locationscaffold_149:10185..11635
Strand+
Gene length (bp)1450
Transcript length (bp)1245
Coding sequence length (bp)1242
Protein length (aa) 414

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.1173 0.1574 0.7822 0.2492 0.0594 0.0179 0.4758 0.2257 0.3805 0.0092

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 45 62 17

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1828
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5585
Ophiocordyceps australis map64 (Brazil) OphauB2|1029
Ophiocordyceps camponoti-floridani Ophcf2|06762
Ophiocordyceps camponoti-rufipedis Ophun1|5758
Ophiocordyceps kimflemingae Ophio5|1411 (this protein)
Ophiocordyceps subramaniannii Hirsu2|181

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1411
MAVSSVPASRESPEYLEAGLLSTGDEDKIRSLAPPPRSMSPLRRLMLAVVLGIFLGFGLSLAKDYVTKPCLSEAA
NVDRVVVVQQRLDSTDLLRRVLHSWFPANLANNLGRSAAGPPVFAGLARRQDDGAGGSNATSRATSSFQPQTSTD
ASSSSASSSADTSSAPVTSSLPSVDTSSATATSSLVGSSSSQALPETSSATSAEPTSLVTAPAITTVSSTPRRQP
TSSFATSSATPEESSSSAAGTSLTNDSTLVATSSSSSAPASLPPSFTSSSSLSTSSVEDSFSSLTTTSPTTTASR
SRFLWQSPSMTMSPGTPTKEESSSPTPTEANRRTVTTGRVSTSSAVRTTWTTTLSDGGVTTLTSTSWVAVVPSET
AAPSSRSREADLQNAAPQMQVEATLFAMVAAFAGAIILI
Coding >Ophio5|1411
ATGGCCGTCTCCTCCGTTCCCGCGAGCCGTGAGAGCCCCGAATATCTCGAAGCTGGGCTGCTGAGCACTGGAGAC
GAGGACAAGATCCGTTCACTTGCACCACCGCCTCGCAGCATGTCGCCCCTGCGGAGGCTGATGCTGGCCGTCGTC
CTTGGCATCTTCCTTGGATTTGGTCTTTCCCTGGCCAAGGATTACGTTACGAAACCGTGTCTCTCTGAAGCTGCC
AACGTTGATCGAGTCGTCGTGGTTCAGCAACGGCTCGACTCGACCGACCTCCTCCGCAGGGTGCTCCATTCTTGG
TTCCCGGCCAACTTGGCCAATAATCTCGGTCGGTCGGCTGCCGGGCCTCCGGTTTTTGCTGGGCTGGCCAGGCGA
CAGGACGATGGTGCGGGCGGAAGCAATGCTACGTCTCGCGCCACGTCCAGCTTCCAGCCCCAGACTTCGACTGAC
GCTTCTTCGTCGTCTGCCTCATCCTCTGCCGACACCTCTTCCGCCCCCGTAACATCGTCTCTGCCTTCTGTCGAC
ACCTCCTCGGCAACCGCCACCTCTTCCCTTGTCGGCTCGTCAAGCAGTCAAGCTCTGCCGGAGACATCGTCTGCC
ACGAGCGCGGAACCGACATCGTTAGTCACGGCCCCGGCTATCACGACCGTCTCCTCCACTCCTCGGCGTCAACCG
ACTTCGTCATTTGCAACGTCGTCTGCGACCCCCGAGGAATCGTCTTCTTCAGCAGCCGGTACGTCCTTGACAAAC
GATTCGACTCTGGTGGCGACGTCCTCGTCCTCCAGTGCTCCAGCCTCTTTGCCTCCTTCTTTCACATCTTCCTCT
TCTCTAAGCACTTCCTCGGTGGAAGACTCTTTTTCATCCTTGACCACTACCTCCCCTACAACGACAGCCTCCAGG
AGCAGGTTCCTATGGCAATCGCCGTCAATGACCATGAGCCCCGGCACGCCGACTAAAGAGGAATCCAGCTCGCCG
ACCCCAACGGAGGCGAATCGCAGGACCGTCACGACGGGACGTGTGTCGACGTCGAGTGCCGTGCGGACGACGTGG
ACGACGACTTTGAGCGACGGGGGCGTTACGACTCTCACGTCGACGTCGTGGGTCGCCGTCGTCCCCTCGGAAACA
GCGGCCCCGTCCAGCCGTTCCAGAGAAGCCGACTTGCAAAACGCTGCGCCACAAATGCAAGTCGAGGCTACACTG
TTCGCAATGGTGGCCGCTTTCGCCGGCGCTATCATACTGATC
Transcript >Ophio5|1411
ATGGCCGTCTCCTCCGTTCCCGCGAGCCGTGAGAGCCCCGAATATCTCGAAGCTGGGCTGCTGAGCACTGGAGAC
GAGGACAAGATCCGTTCACTTGCACCACCGCCTCGCAGCATGTCGCCCCTGCGGAGGCTGATGCTGGCCGTCGTC
CTTGGCATCTTCCTTGGATTTGGTCTTTCCCTGGCCAAGGATTACGTTACGAAACCGTGTCTCTCTGAAGCTGCC
AACGTTGATCGAGTCGTCGTGGTTCAGCAACGGCTCGACTCGACCGACCTCCTCCGCAGGGTGCTCCATTCTTGG
TTCCCGGCCAACTTGGCCAATAATCTCGGTCGGTCGGCTGCCGGGCCTCCGGTTTTTGCTGGGCTGGCCAGGCGA
CAGGACGATGGTGCGGGCGGAAGCAATGCTACGTCTCGCGCCACGTCCAGCTTCCAGCCCCAGACTTCGACTGAC
GCTTCTTCGTCGTCTGCCTCATCCTCTGCCGACACCTCTTCCGCCCCCGTAACATCGTCTCTGCCTTCTGTCGAC
ACCTCCTCGGCAACCGCCACCTCTTCCCTTGTCGGCTCGTCAAGCAGTCAAGCTCTGCCGGAGACATCGTCTGCC
ACGAGCGCGGAACCGACATCGTTAGTCACGGCCCCGGCTATCACGACCGTCTCCTCCACTCCTCGGCGTCAACCG
ACTTCGTCATTTGCAACGTCGTCTGCGACCCCCGAGGAATCGTCTTCTTCAGCAGCCGGTACGTCCTTGACAAAC
GATTCGACTCTGGTGGCGACGTCCTCGTCCTCCAGTGCTCCAGCCTCTTTGCCTCCTTCTTTCACATCTTCCTCT
TCTCTAAGCACTTCCTCGGTGGAAGACTCTTTTTCATCCTTGACCACTACCTCCCCTACAACGACAGCCTCCAGG
AGCAGGTTCCTATGGCAATCGCCGTCAATGACCATGAGCCCCGGCACGCCGACTAAAGAGGAATCCAGCTCGCCG
ACCCCAACGGAGGCGAATCGCAGGACCGTCACGACGGGACGTGTGTCGACGTCGAGTGCCGTGCGGACGACGTGG
ACGACGACTTTGAGCGACGGGGGCGTTACGACTCTCACGTCGACGTCGTGGGTCGCCGTCGTCCCCTCGGAAACA
GCGGCCCCGTCCAGCCGTTCCAGAGAAGCCGACTTGCAAAACGCTGCGCCACAAATGCAAGTCGAGGCTACACTG
TTCGCAATGGTGGCCGCTTTCGCCGGCGCTATCATACTGATCTAG
Gene >Ophio5|1411
ATGGCCGTCTCCTCCGTTCCCGCGAGCCGTGAGAGCCCCGAATATCTCGAAGCTGGGCTGCTGAGCACTGGAGAC
GAGGACAAGATCCGTTCACTTGCACCACCGCCTCGCAGCATGTCGCCCCTGCGGAGGCTGATGCTGGCCGTCGTC
CTTGGCATCTTCCTTGGATTTGGTCTTTCCCTGGCCAAGGATTACGTTACGAAACCGTGTCTCTCTGAAGCTGCC
AACGTTGATCGAGTCGTCGTGGTTCAGCAACGGCTCGACTCGACCGACCTCCTCCGCAGGGTGCTCCATTCTTGG
TTCCCGGCCAACTTGGCCAATAATCTCGGTCGGTCGGCTGCCGGGCCTCCGGTTTTTGCTGGGCTGGCCAGGCGA
CAGGACGATGGTGCGGGCGGAAGCAATGCTACGTCTCGCGCCACGTCCAGCTTCCAGCCCCAGACTTCGACTGAC
GCTTCTTCGTCGTCTGCCTCATCCTCTGCCGACACCTCTTCCGCCCCCGTAACATCGTCTCTGCCTTCTGTCGAC
ACCTCCTCGGCAACCGCCACCTCTTCCCTTGGTACGTGTCATGTTGCTTGTGTCGGCACCTCGTCCGTCCACTGA
CATCATATCTAGTCGGCTCGTCAAGCAGTCAAGCTCTGCCGGAGACATCGTCTGCCACGAGCGCGGAACCGACAT
CGTTAGTCACGGCCCCGGCTATCACGACCGTCTCCTCCACTCCTCGGCGTCAACCGACTTCGTCATTTGCAACGT
CGTCTGCGACCCCCGAGGAATCGTCTTCTTCAGCAGCCGGTACGTCCTTGACAAACGATTCGACTCTGGTGGCGA
CGTCCTCGTCCTCCAGTGCTCCAGCCTCTTTGCCTCCTTCTTTCACATCTTCCTCTTCTCTAAGCACTTCCTCGG
TGGAAGACTCTTTTTCATCCTTGACCACTACCTCCCCTACAACGACAGCCTCCAGGAGCAGGTTCCTATGGCAAT
CGCCGTCAATGACCATGAGCCCCGGCACGCCGACTAAAGGTGACTGCGAGCTGCATGGCCGTTACATACCATCCC
CCATGAGCAGCTCACTATTGCTCGCCGCAAGTGTGGCTGAACGTTGAATCACTACATTTATATCTGGCACCCATA
CTGCTTACCCCCGAGTCTTATTGCTGACAATGTAGCAGAGGAATCCAGCTCGCCGACCCCAACGGAGGCGAATCG
CAGGACCGTCACGACGGGACGTGTGTCGACGTCGAGTGCCGTGCGGACGACGTGGACGACGACTTTGAGCGACGG
GGGCGTTACGACTCTCACGTCGACGTCGTGGGTCGCCGTCGTCCCCTCGGAAACAGCGGCCCCGTCCAGCCGTTC
CAGAGAAGCCGACTTGCAAAACGCTGCGCCACAAATGCAAGTCGAGGCTACACTGTTCGCAATGGTGGCCGCTTT
CGCCGGCGCTATCATACTGATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail