Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1410
Gene name
Locationscaffold_149:5656..8303
Strand-
Gene length (bp)2647
Transcript length (bp)2592
Coding sequence length (bp)2589
Protein length (aa) 863

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 637 861 2.0E-32
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 603 856 3.0E-25
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 617 859 6.0E-20
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 606 801 2.0E-18
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 608 801 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 637 861 2.0E-32
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 603 856 3.0E-25
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 617 859 6.0E-20
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 606 801 2.0E-18
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 608 801 3.0E-17
sp|Q8R2Y3|DOLK_MOUSE Dolichol kinase OS=Mus musculus GN=Dolk PE=1 SV=1 608 801 7.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 192 211 19
2 343 362 19
3 366 388 22
4 523 545 22
5 609 631 22
6 643 677 34
7 709 731 22
8 752 774 22
9 789 811 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 38.71 20.99 56.44
CcL In ants, during behavior modification 104.99 51.28 158.70
CcD In ants, recently dead 68.82 36.73 100.90

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.009031 yes
CcL CcD 0.074677 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1410
MPEPSSSSTDEVSTAPKTDEASAILKPDDQRPYRTLSRSPHPYHHQTAERCVLDNHPSPPRHQTPPHFTKDSSPA
SESGTDADDEHFLKGLPAPRVRLHKGLRGQNEFLSRPFTPLSYPASSQDELPPPVVEQSLVETRVSFGCRLRDAT
FRNKVLIRRATELCLVASLGRIVRSNAHVSLLLSVWRREFQLLGLLLAALLALHPLRVLAWAYRRHRPSRLLPFK
IPSDFDPAPLLYPPAITVFASLLISVGNPAVLLPNIILSICALPRSLIPTIEPAAPFDIPHWLVSGLPLIWTSSG
TTHSARQGLAGETLVLLHPLHQTLCSVLQHLTTTSLLEAELQLLSVALINILILAVSPQIEVLKALLWVGGLSAI
VFCGPVITWGISLARVPKWRFRKAFDRRKDARRLLSWRRARKGFLGLFRGDGFDEFNSSSEDDESSSRFVGPSRV
RTLGPGGRKDRAVSVLPEEDRKNPGAMPRRHTMPHSDKSRIAYTSSGRRRRATSGSARPFLRLTQTQATRRKWLY
ALYVYACLLAIILVGVRTHVQRYALGGHEPIGWGLGYVLGDWPWFRFQVVQANLERWICLTELAGRHDGRVQRLR
LVVWGEANTRLLLGGYWLAILVVGLMIVFRLKEMYEVDTRRKVFHFMMVGMFLPGTYVDPAFAALALSLVLAIFL
ILDLLRASQLPPLSKPIASFLAPYVDGRDFRGSVVVSHIFLLIGCAIPLWLALATVPRTGTACRAGWEVPTREVS
MVSGVVCVGLGDAAASLIGRRYGHRKWLWGGGKSLEGSAAFAVAVFVGLAVASAWLRAGGWPATEAAIGPLASAR
NAAVCASVASMTEAVLTGGNDNVIVPVVLWTCVKSLGV
Coding >Ophio5|1410
ATGCCGGAGCCTTCCTCCTCCTCCACCGACGAGGTCTCGACCGCTCCTAAGACTGACGAGGCCTCGGCCATTCTA
AAGCCCGACGACCAGCGACCCTATCGCACCCTGAGCCGCTCCCCACACCCCTACCACCACCAGACTGCCGAGAGA
TGCGTCCTCGACAACCATCCATCTCCGCCGCGCCACCAGACGCCACCACACTTTACCAAGGACTCGTCTCCAGCC
AGCGAGAGCGGCACCGACGCCGACGACGAGCACTTCCTCAAAGGTCTTCCTGCGCCCCGCGTGAGGTTGCACAAG
GGGCTACGCGGCCAGAACGAGTTCTTATCGCGTCCCTTTACGCCCCTGTCCTATCCTGCCTCTTCTCAAGATGAG
CTACCGCCGCCCGTCGTCGAGCAGAGCCTCGTCGAAACTCGCGTCTCTTTTGGCTGCCGCTTGCGAGACGCCACA
TTTCGCAACAAAGTCCTGATTCGGCGCGCGACGGAGCTGTGCCTCGTCGCGTCGCTGGGGCGCATAGTGCGCTCC
AACGCTCACGTCTCCTTGTTATTGAGCGTCTGGCGCCGAGAATTTCAGCTTCTGGGCCTGCTGCTCGCCGCCTTA
CTGGCTCTTCATCCCCTTCGTGTCCTCGCATGGGCCTACCGCCGCCATCGCCCATCGCGGTTATTACCTTTTAAA
ATCCCGTCCGACTTCGATCCGGCACCTCTGCTGTACCCACCAGCCATCACTGTTTTTGCATCACTCCTGATTTCC
GTCGGAAACCCCGCCGTTCTTCTCCCCAACATCATTCTCAGCATATGCGCATTACCGCGTTCATTGATCCCAACC
ATTGAGCCCGCCGCTCCCTTTGATATCCCCCATTGGCTCGTCTCAGGCCTGCCTCTCATATGGACTTCATCCGGT
ACAACACACTCGGCCCGACAAGGTTTGGCGGGGGAGACGCTCGTCTTGCTGCATCCACTGCACCAGACGTTGTGC
TCCGTCTTGCAACATCTCACGACCACAAGCCTCCTGGAAGCCGAGCTTCAGCTGCTTTCGGTTGCCTTGATTAAC
ATTCTCATCTTAGCCGTCTCGCCTCAGATTGAGGTGCTCAAGGCACTGCTCTGGGTGGGGGGCCTGTCAGCCATC
GTGTTTTGTGGTCCGGTCATAACGTGGGGGATCTCCCTGGCGCGGGTTCCCAAATGGCGTTTTCGAAAGGCTTTT
GACCGTCGGAAGGACGCGCGCCGGCTTCTGTCGTGGCGCAGAGCCAGAAAGGGATTCCTTGGGCTGTTTAGAGGT
GACGGCTTCGACGAGTTCAACTCGTCATCTGAGGACGACGAGAGCTCGTCCCGCTTCGTCGGTCCCTCGAGAGTC
CGGACGCTCGGTCCCGGCGGCCGCAAGGACCGAGCCGTCTCCGTACTGCCCGAGGAGGACCGCAAAAACCCGGGC
GCCATGCCACGGAGACATACCATGCCGCATTCAGACAAGTCGCGCATCGCCTACACGTCGTCCGGACGGAGGAGG
CGGGCGACTTCGGGCTCGGCACGGCCCTTTCTCCGCCTGACGCAGACGCAGGCAACACGCAGGAAGTGGCTCTAC
GCGCTCTACGTCTACGCGTGCCTGCTGGCCATCATCTTGGTCGGCGTCCGCACCCACGTGCAAAGGTACGCGCTC
GGCGGCCACGAGCCCATCGGCTGGGGCTTGGGCTACGTCCTAGGAGACTGGCCGTGGTTCCGTTTCCAGGTGGTC
CAGGCCAATCTCGAGCGCTGGATCTGCCTGACGGAGCTGGCGGGGCGGCACGACGGCCGGGTGCAGCGCCTCCGG
CTCGTCGTCTGGGGCGAGGCGAATACGAGGCTGCTCCTGGGCGGGTACTGGCTCGCCATCCTCGTCGTCGGCCTG
ATGATTGTGTTTCGGCTCAAGGAGATGTACGAGGTGGACACGCGGCGGAAGGTGTTTCACTTCATGATGGTTGGT
ATGTTCCTCCCAGGCACCTACGTCGATCCGGCCTTTGCAGCCCTGGCGCTATCCCTGGTCCTGGCCATTTTTCTC
ATCCTGGACCTGCTGCGGGCGAGCCAGCTGCCTCCGCTGTCGAAGCCCATCGCCTCCTTTCTGGCGCCCTACGTG
GACGGGAGAGACTTTCGAGGCTCGGTCGTGGTATCGCACATATTTTTGCTCATCGGATGCGCCATACCACTGTGG
CTGGCTCTCGCCACGGTGCCTCGGACGGGGACGGCATGCCGAGCCGGCTGGGAGGTGCCGACGAGGGAGGTGAGC
ATGGTGTCGGGCGTCGTCTGTGTCGGCCTCGGCGACGCGGCCGCCTCCCTCATCGGTCGCCGTTACGGGCACCGC
AAGTGGCTTTGGGGCGGCGGAAAGAGCCTCGAAGGGAGCGCTGCGTTTGCCGTCGCCGTTTTCGTCGGCTTGGCC
GTCGCGAGCGCCTGGCTTCGGGCTGGGGGATGGCCAGCGACGGAGGCTGCTATCGGGCCGCTGGCGAGCGCGCGG
AATGCCGCCGTGTGCGCTTCTGTGGCCAGCATGACCGAGGCGGTCCTGACGGGCGGCAACGACAACGTCATTGTG
CCTGTCGTGCTCTGGACCTGCGTCAAGAGTCTCGGCGTC
Transcript >Ophio5|1410
ATGCCGGAGCCTTCCTCCTCCTCCACCGACGAGGTCTCGACCGCTCCTAAGACTGACGAGGCCTCGGCCATTCTA
AAGCCCGACGACCAGCGACCCTATCGCACCCTGAGCCGCTCCCCACACCCCTACCACCACCAGACTGCCGAGAGA
TGCGTCCTCGACAACCATCCATCTCCGCCGCGCCACCAGACGCCACCACACTTTACCAAGGACTCGTCTCCAGCC
AGCGAGAGCGGCACCGACGCCGACGACGAGCACTTCCTCAAAGGTCTTCCTGCGCCCCGCGTGAGGTTGCACAAG
GGGCTACGCGGCCAGAACGAGTTCTTATCGCGTCCCTTTACGCCCCTGTCCTATCCTGCCTCTTCTCAAGATGAG
CTACCGCCGCCCGTCGTCGAGCAGAGCCTCGTCGAAACTCGCGTCTCTTTTGGCTGCCGCTTGCGAGACGCCACA
TTTCGCAACAAAGTCCTGATTCGGCGCGCGACGGAGCTGTGCCTCGTCGCGTCGCTGGGGCGCATAGTGCGCTCC
AACGCTCACGTCTCCTTGTTATTGAGCGTCTGGCGCCGAGAATTTCAGCTTCTGGGCCTGCTGCTCGCCGCCTTA
CTGGCTCTTCATCCCCTTCGTGTCCTCGCATGGGCCTACCGCCGCCATCGCCCATCGCGGTTATTACCTTTTAAA
ATCCCGTCCGACTTCGATCCGGCACCTCTGCTGTACCCACCAGCCATCACTGTTTTTGCATCACTCCTGATTTCC
GTCGGAAACCCCGCCGTTCTTCTCCCCAACATCATTCTCAGCATATGCGCATTACCGCGTTCATTGATCCCAACC
ATTGAGCCCGCCGCTCCCTTTGATATCCCCCATTGGCTCGTCTCAGGCCTGCCTCTCATATGGACTTCATCCGGT
ACAACACACTCGGCCCGACAAGGTTTGGCGGGGGAGACGCTCGTCTTGCTGCATCCACTGCACCAGACGTTGTGC
TCCGTCTTGCAACATCTCACGACCACAAGCCTCCTGGAAGCCGAGCTTCAGCTGCTTTCGGTTGCCTTGATTAAC
ATTCTCATCTTAGCCGTCTCGCCTCAGATTGAGGTGCTCAAGGCACTGCTCTGGGTGGGGGGCCTGTCAGCCATC
GTGTTTTGTGGTCCGGTCATAACGTGGGGGATCTCCCTGGCGCGGGTTCCCAAATGGCGTTTTCGAAAGGCTTTT
GACCGTCGGAAGGACGCGCGCCGGCTTCTGTCGTGGCGCAGAGCCAGAAAGGGATTCCTTGGGCTGTTTAGAGGT
GACGGCTTCGACGAGTTCAACTCGTCATCTGAGGACGACGAGAGCTCGTCCCGCTTCGTCGGTCCCTCGAGAGTC
CGGACGCTCGGTCCCGGCGGCCGCAAGGACCGAGCCGTCTCCGTACTGCCCGAGGAGGACCGCAAAAACCCGGGC
GCCATGCCACGGAGACATACCATGCCGCATTCAGACAAGTCGCGCATCGCCTACACGTCGTCCGGACGGAGGAGG
CGGGCGACTTCGGGCTCGGCACGGCCCTTTCTCCGCCTGACGCAGACGCAGGCAACACGCAGGAAGTGGCTCTAC
GCGCTCTACGTCTACGCGTGCCTGCTGGCCATCATCTTGGTCGGCGTCCGCACCCACGTGCAAAGGTACGCGCTC
GGCGGCCACGAGCCCATCGGCTGGGGCTTGGGCTACGTCCTAGGAGACTGGCCGTGGTTCCGTTTCCAGGTGGTC
CAGGCCAATCTCGAGCGCTGGATCTGCCTGACGGAGCTGGCGGGGCGGCACGACGGCCGGGTGCAGCGCCTCCGG
CTCGTCGTCTGGGGCGAGGCGAATACGAGGCTGCTCCTGGGCGGGTACTGGCTCGCCATCCTCGTCGTCGGCCTG
ATGATTGTGTTTCGGCTCAAGGAGATGTACGAGGTGGACACGCGGCGGAAGGTGTTTCACTTCATGATGGTTGGT
ATGTTCCTCCCAGGCACCTACGTCGATCCGGCCTTTGCAGCCCTGGCGCTATCCCTGGTCCTGGCCATTTTTCTC
ATCCTGGACCTGCTGCGGGCGAGCCAGCTGCCTCCGCTGTCGAAGCCCATCGCCTCCTTTCTGGCGCCCTACGTG
GACGGGAGAGACTTTCGAGGCTCGGTCGTGGTATCGCACATATTTTTGCTCATCGGATGCGCCATACCACTGTGG
CTGGCTCTCGCCACGGTGCCTCGGACGGGGACGGCATGCCGAGCCGGCTGGGAGGTGCCGACGAGGGAGGTGAGC
ATGGTGTCGGGCGTCGTCTGTGTCGGCCTCGGCGACGCGGCCGCCTCCCTCATCGGTCGCCGTTACGGGCACCGC
AAGTGGCTTTGGGGCGGCGGAAAGAGCCTCGAAGGGAGCGCTGCGTTTGCCGTCGCCGTTTTCGTCGGCTTGGCC
GTCGCGAGCGCCTGGCTTCGGGCTGGGGGATGGCCAGCGACGGAGGCTGCTATCGGGCCGCTGGCGAGCGCGCGG
AATGCCGCCGTGTGCGCTTCTGTGGCCAGCATGACCGAGGCGGTCCTGACGGGCGGCAACGACAACGTCATTGTG
CCTGTCGTGCTCTGGACCTGCGTCAAGAGTCTCGGCGTCTAA
Gene >Ophio5|1410
ATGCCGGAGCCTTCCTCCTCCTCCACCGACGAGGTCTCGACCGCTCCTAAGACTGACGAGGCCTCGGCCATTCTA
AAGCCCGACGACCAGCGACCCTATCGCACCCTGAGCCGCTCCCCACACCCCTACCACCACCAGACTGCCGAGAGA
TGCGTCCTCGACAACCATCCATCTCCGCCGCGCCACCAGACGCCACCACACTTTACCAAGGACTCGTCTCCAGCC
AGCGAGAGCGGCACCGACGCCGACGACGAGCACTTCCTCAAAGGTCTTCCTGCGCCCCGCGTGAGGTTGCACAAG
GGGCTACGCGGCCAGAACGAGTTCTTATCGCGTCCCTTTACGCCCCTGTCCTATCCTGCCTCTTCTCAAGATGAG
CTACCGCCGCCCGTCGTCGAGCAGAGCCTCGTCGAAACTCGCGTCTCTTTTGGCTGCCGCTTGCGAGACGCCACA
TTTCGCAACAAAGTCCTGATTCGGCGCGCGACGGAGCTGTGCCTCGTCGCGTCGCTGGGGCGCATAGTGCGCTCC
AACGCTCACGTCTCCTTGTTATTGAGCGTCTGGCGCCGAGGTAGGCTTTTGCTCTTTCCGCTGTCACCTGTCAAT
CTTGGTCTTACTGTAATTAGAATTTCAGCTTCTGGGCCTGCTGCTCGCCGCCTTACTGGCTCTTCATCCCCTTCG
TGTCCTCGCATGGGCCTACCGCCGCCATCGCCCATCGCGGTTATTACCTTTTAAAATCCCGTCCGACTTCGATCC
GGCACCTCTGCTGTACCCACCAGCCATCACTGTTTTTGCATCACTCCTGATTTCCGTCGGAAACCCCGCCGTTCT
TCTCCCCAACATCATTCTCAGCATATGCGCATTACCGCGTTCATTGATCCCAACCATTGAGCCCGCCGCTCCCTT
TGATATCCCCCATTGGCTCGTCTCAGGCCTGCCTCTCATATGGACTTCATCCGGTACAACACACTCGGCCCGACA
AGGTTTGGCGGGGGAGACGCTCGTCTTGCTGCATCCACTGCACCAGACGTTGTGCTCCGTCTTGCAACATCTCAC
GACCACAAGCCTCCTGGAAGCCGAGCTTCAGCTGCTTTCGGTTGCCTTGATTAACATTCTCATCTTAGCCGTCTC
GCCTCAGATTGAGGTGCTCAAGGCACTGCTCTGGGTGGGGGGCCTGTCAGCCATCGTGTTTTGTGGTCCGGTCAT
AACGTGGGGGATCTCCCTGGCGCGGGTTCCCAAATGGCGTTTTCGAAAGGCTTTTGACCGTCGGAAGGACGCGCG
CCGGCTTCTGTCGTGGCGCAGAGCCAGAAAGGGATTCCTTGGGCTGTTTAGAGGTGACGGCTTCGACGAGTTCAA
CTCGTCATCTGAGGACGACGAGAGCTCGTCCCGCTTCGTCGGTCCCTCGAGAGTCCGGACGCTCGGTCCCGGCGG
CCGCAAGGACCGAGCCGTCTCCGTACTGCCCGAGGAGGACCGCAAAAACCCGGGCGCCATGCCACGGAGACATAC
CATGCCGCATTCAGACAAGTCGCGCATCGCCTACACGTCGTCCGGACGGAGGAGGCGGGCGACTTCGGGCTCGGC
ACGGCCCTTTCTCCGCCTGACGCAGACGCAGGCAACACGCAGGAAGTGGCTCTACGCGCTCTACGTCTACGCGTG
CCTGCTGGCCATCATCTTGGTCGGCGTCCGCACCCACGTGCAAAGGTACGCGCTCGGCGGCCACGAGCCCATCGG
CTGGGGCTTGGGCTACGTCCTAGGAGACTGGCCGTGGTTCCGTTTCCAGGTGGTCCAGGCCAATCTCGAGCGCTG
GATCTGCCTGACGGAGCTGGCGGGGCGGCACGACGGCCGGGTGCAGCGCCTCCGGCTCGTCGTCTGGGGCGAGGC
GAATACGAGGCTGCTCCTGGGCGGGTACTGGCTCGCCATCCTCGTCGTCGGCCTGATGATTGTGTTTCGGCTCAA
GGAGATGTACGAGGTGGACACGCGGCGGAAGGTGTTTCACTTCATGATGGTTGGTATGTTCCTCCCAGGCACCTA
CGTCGATCCGGCCTTTGCAGCCCTGGCGCTATCCCTGGTCCTGGCCATTTTTCTCATCCTGGACCTGCTGCGGGC
GAGCCAGCTGCCTCCGCTGTCGAAGCCCATCGCCTCCTTTCTGGCGCCCTACGTGGACGGGAGAGACTTTCGAGG
CTCGGTCGTGGTATCGCACATATTTTTGCTCATCGGATGCGCCATACCACTGTGGCTGGCTCTCGCCACGGTGCC
TCGGACGGGGACGGCATGCCGAGCCGGCTGGGAGGTGCCGACGAGGGAGGTGAGCATGGTGTCGGGCGTCGTCTG
TGTCGGCCTCGGCGACGCGGCCGCCTCCCTCATCGGTCGCCGTTACGGGCACCGCAAGTGGCTTTGGGGCGGCGG
AAAGAGCCTCGAAGGGAGCGCTGCGTTTGCCGTCGCCGTTTTCGTCGGCTTGGCCGTCGCGAGCGCCTGGCTTCG
GGCTGGGGGATGGCCAGCGACGGAGGCTGCTATCGGGCCGCTGGCGAGCGCGCGGAATGCCGCCGTGTGCGCTTC
TGTGGCCAGCATGACCGAGGCGGTCCTGACGGGCGGCAACGACAACGTCATTGTGCCTGTCGTGCTCTGGACCTG
CGTCAAGAGTCTCGGCGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail