Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1410
Gene name
Locationscaffold_149:5656..8303
Strand-
Gene length (bp)2647
Transcript length (bp)2592
Coding sequence length (bp)2589
Protein length (aa) 863

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 637 861 2.0E-32
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 603 856 3.0E-25
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 617 859 6.0E-20
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 606 801 2.0E-18
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 608 801 3.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7T6|SEC59_SCHPO Dolichol kinase sec59 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec59 PE=3 SV=3 637 861 2.0E-32
sp|F4J4C8|EVN_ARATH Dolichol kinase EVAN OS=Arabidopsis thaliana GN=EVN PE=2 SV=1 603 856 3.0E-25
sp|P20048|SEC59_YEAST Dolichol kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC59 PE=1 SV=1 617 859 6.0E-20
sp|Q58CR4|DOLK_BOVIN Dolichol kinase OS=Bos taurus GN=DOLK PE=2 SV=1 606 801 2.0E-18
sp|Q9UPQ8|DOLK_HUMAN Dolichol kinase OS=Homo sapiens GN=DOLK PE=1 SV=1 608 801 3.0E-17
sp|Q8R2Y3|DOLK_MOUSE Dolichol kinase OS=Mus musculus GN=Dolk PE=1 SV=1 608 801 7.0E-17
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

Domain # Start End Length
1 192 211 19
2 343 362 19
3 366 388 22
4 523 545 22
5 609 631 22
6 643 677 34
7 709 731 22
8 752 774 22
9 789 811 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1410
MPEPSSSSTDEVSTAPKTDEASAILKPDDQRPYRTLSRSPHPYHHQTAERCVLDNHPSPPRHQTPPHFTKDSSPA
SESGTDADDEHFLKGLPAPRVRLHKGLRGQNEFLSRPFTPLSYPASSQDELPPPVVEQSLVETRVSFGCRLRDAT
FRNKVLIRRATELCLVASLGRIVRSNAHVSLLLSVWRREFQLLGLLLAALLALHPLRVLAWAYRRHRPSRLLPFK
IPSDFDPAPLLYPPAITVFASLLISVGNPAVLLPNIILSICALPRSLIPTIEPAAPFDIPHWLVSGLPLIWTSSG
TTHSARQGLAGETLVLLHPLHQTLCSVLQHLTTTSLLEAELQLLSVALINILILAVSPQIEVLKALLWVGGLSAI
VFCGPVITWGISLARVPKWRFRKAFDRRKDARRLLSWRRARKGFLGLFRGDGFDEFNSSSEDDESSSRFVGPSRV
RTLGPGGRKDRAVSVLPEEDRKNPGAMPRRHTMPHSDKSRIAYTSSGRRRRATSGSARPFLRLTQTQATRRKWLY
ALYVYACLLAIILVGVRTHVQRYALGGHEPIGWGLGYVLGDWPWFRFQVVQANLERWICLTELAGRHDGRVQRLR
LVVWGEANTRLLLGGYWLAILVVGLMIVFRLKEMYEVDTRRKVFHFMMVGMFLPGTYVDPAFAALALSLVLAIFL
ILDLLRASQLPPLSKPIASFLAPYVDGRDFRGSVVVSHIFLLIGCAIPLWLALATVPRTGTACRAGWEVPTREVS
MVSGVVCVGLGDAAASLIGRRYGHRKWLWGGGKSLEGSAAFAVAVFVGLAVASAWLRAGGWPATEAAIGPLASAR
NAAVCASVASMTEAVLTGGNDNVIVPVVLWTCVKSLGV
Coding >Ophio5|1410
ATGCCGGAGCCTTCCTCCTCCTCCACCGACGAGGTCTCGACCGCTCCTAAGACTGACGAGGCCTCGGCCATTCTA
AAGCCCGACGACCAGCGACCCTATCGCACCCTGAGCCGCTCCCCACACCCCTACCACCACCAGACTGCCGAGAGA
TGCGTCCTCGACAACCATCCATCTCCGCCGCGCCACCAGACGCCACCACACTTTACCAAGGACTCGTCTCCAGCC
AGCGAGAGCGGCACCGACGCCGACGACGAGCACTTCCTCAAAGGTCTTCCTGCGCCCCGCGTGAGGTTGCACAAG
GGGCTACGCGGCCAGAACGAGTTCTTATCGCGTCCCTTTACGCCCCTGTCCTATCCTGCCTCTTCTCAAGATGAG
CTACCGCCGCCCGTCGTCGAGCAGAGCCTCGTCGAAACTCGCGTCTCTTTTGGCTGCCGCTTGCGAGACGCCACA
TTTCGCAACAAAGTCCTGATTCGGCGCGCGACGGAGCTGTGCCTCGTCGCGTCGCTGGGGCGCATAGTGCGCTCC
AACGCTCACGTCTCCTTGTTATTGAGCGTCTGGCGCCGAGAATTTCAGCTTCTGGGCCTGCTGCTCGCCGCCTTA
CTGGCTCTTCATCCCCTTCGTGTCCTCGCATGGGCCTACCGCCGCCATCGCCCATCGCGGTTATTACCTTTTAAA
ATCCCGTCCGACTTCGATCCGGCACCTCTGCTGTACCCACCAGCCATCACTGTTTTTGCATCACTCCTGATTTCC
GTCGGAAACCCCGCCGTTCTTCTCCCCAACATCATTCTCAGCATATGCGCATTACCGCGTTCATTGATCCCAACC
ATTGAGCCCGCCGCTCCCTTTGATATCCCCCATTGGCTCGTCTCAGGCCTGCCTCTCATATGGACTTCATCCGGT
ACAACACACTCGGCCCGACAAGGTTTGGCGGGGGAGACGCTCGTCTTGCTGCATCCACTGCACCAGACGTTGTGC
TCCGTCTTGCAACATCTCACGACCACAAGCCTCCTGGAAGCCGAGCTTCAGCTGCTTTCGGTTGCCTTGATTAAC
ATTCTCATCTTAGCCGTCTCGCCTCAGATTGAGGTGCTCAAGGCACTGCTCTGGGTGGGGGGCCTGTCAGCCATC
GTGTTTTGTGGTCCGGTCATAACGTGGGGGATCTCCCTGGCGCGGGTTCCCAAATGGCGTTTTCGAAAGGCTTTT
GACCGTCGGAAGGACGCGCGCCGGCTTCTGTCGTGGCGCAGAGCCAGAAAGGGATTCCTTGGGCTGTTTAGAGGT
GACGGCTTCGACGAGTTCAACTCGTCATCTGAGGACGACGAGAGCTCGTCCCGCTTCGTCGGTCCCTCGAGAGTC
CGGACGCTCGGTCCCGGCGGCCGCAAGGACCGAGCCGTCTCCGTACTGCCCGAGGAGGACCGCAAAAACCCGGGC
GCCATGCCACGGAGACATACCATGCCGCATTCAGACAAGTCGCGCATCGCCTACACGTCGTCCGGACGGAGGAGG
CGGGCGACTTCGGGCTCGGCACGGCCCTTTCTCCGCCTGACGCAGACGCAGGCAACACGCAGGAAGTGGCTCTAC
GCGCTCTACGTCTACGCGTGCCTGCTGGCCATCATCTTGGTCGGCGTCCGCACCCACGTGCAAAGGTACGCGCTC
GGCGGCCACGAGCCCATCGGCTGGGGCTTGGGCTACGTCCTAGGAGACTGGCCGTGGTTCCGTTTCCAGGTGGTC
CAGGCCAATCTCGAGCGCTGGATCTGCCTGACGGAGCTGGCGGGGCGGCACGACGGCCGGGTGCAGCGCCTCCGG
CTCGTCGTCTGGGGCGAGGCGAATACGAGGCTGCTCCTGGGCGGGTACTGGCTCGCCATCCTCGTCGTCGGCCTG
ATGATTGTGTTTCGGCTCAAGGAGATGTACGAGGTGGACACGCGGCGGAAGGTGTTTCACTTCATGATGGTTGGT
ATGTTCCTCCCAGGCACCTACGTCGATCCGGCCTTTGCAGCCCTGGCGCTATCCCTGGTCCTGGCCATTTTTCTC
ATCCTGGACCTGCTGCGGGCGAGCCAGCTGCCTCCGCTGTCGAAGCCCATCGCCTCCTTTCTGGCGCCCTACGTG
GACGGGAGAGACTTTCGAGGCTCGGTCGTGGTATCGCACATATTTTTGCTCATCGGATGCGCCATACCACTGTGG
CTGGCTCTCGCCACGGTGCCTCGGACGGGGACGGCATGCCGAGCCGGCTGGGAGGTGCCGACGAGGGAGGTGAGC
ATGGTGTCGGGCGTCGTCTGTGTCGGCCTCGGCGACGCGGCCGCCTCCCTCATCGGTCGCCGTTACGGGCACCGC
AAGTGGCTTTGGGGCGGCGGAAAGAGCCTCGAAGGGAGCGCTGCGTTTGCCGTCGCCGTTTTCGTCGGCTTGGCC
GTCGCGAGCGCCTGGCTTCGGGCTGGGGGATGGCCAGCGACGGAGGCTGCTATCGGGCCGCTGGCGAGCGCGCGG
AATGCCGCCGTGTGCGCTTCTGTGGCCAGCATGACCGAGGCGGTCCTGACGGGCGGCAACGACAACGTCATTGTG
CCTGTCGTGCTCTGGACCTGCGTCAAGAGTCTCGGCGTC
Transcript >Ophio5|1410
ATGCCGGAGCCTTCCTCCTCCTCCACCGACGAGGTCTCGACCGCTCCTAAGACTGACGAGGCCTCGGCCATTCTA
AAGCCCGACGACCAGCGACCCTATCGCACCCTGAGCCGCTCCCCACACCCCTACCACCACCAGACTGCCGAGAGA
TGCGTCCTCGACAACCATCCATCTCCGCCGCGCCACCAGACGCCACCACACTTTACCAAGGACTCGTCTCCAGCC
AGCGAGAGCGGCACCGACGCCGACGACGAGCACTTCCTCAAAGGTCTTCCTGCGCCCCGCGTGAGGTTGCACAAG
GGGCTACGCGGCCAGAACGAGTTCTTATCGCGTCCCTTTACGCCCCTGTCCTATCCTGCCTCTTCTCAAGATGAG
CTACCGCCGCCCGTCGTCGAGCAGAGCCTCGTCGAAACTCGCGTCTCTTTTGGCTGCCGCTTGCGAGACGCCACA
TTTCGCAACAAAGTCCTGATTCGGCGCGCGACGGAGCTGTGCCTCGTCGCGTCGCTGGGGCGCATAGTGCGCTCC
AACGCTCACGTCTCCTTGTTATTGAGCGTCTGGCGCCGAGAATTTCAGCTTCTGGGCCTGCTGCTCGCCGCCTTA
CTGGCTCTTCATCCCCTTCGTGTCCTCGCATGGGCCTACCGCCGCCATCGCCCATCGCGGTTATTACCTTTTAAA
ATCCCGTCCGACTTCGATCCGGCACCTCTGCTGTACCCACCAGCCATCACTGTTTTTGCATCACTCCTGATTTCC
GTCGGAAACCCCGCCGTTCTTCTCCCCAACATCATTCTCAGCATATGCGCATTACCGCGTTCATTGATCCCAACC
ATTGAGCCCGCCGCTCCCTTTGATATCCCCCATTGGCTCGTCTCAGGCCTGCCTCTCATATGGACTTCATCCGGT
ACAACACACTCGGCCCGACAAGGTTTGGCGGGGGAGACGCTCGTCTTGCTGCATCCACTGCACCAGACGTTGTGC
TCCGTCTTGCAACATCTCACGACCACAAGCCTCCTGGAAGCCGAGCTTCAGCTGCTTTCGGTTGCCTTGATTAAC
ATTCTCATCTTAGCCGTCTCGCCTCAGATTGAGGTGCTCAAGGCACTGCTCTGGGTGGGGGGCCTGTCAGCCATC
GTGTTTTGTGGTCCGGTCATAACGTGGGGGATCTCCCTGGCGCGGGTTCCCAAATGGCGTTTTCGAAAGGCTTTT
GACCGTCGGAAGGACGCGCGCCGGCTTCTGTCGTGGCGCAGAGCCAGAAAGGGATTCCTTGGGCTGTTTAGAGGT
GACGGCTTCGACGAGTTCAACTCGTCATCTGAGGACGACGAGAGCTCGTCCCGCTTCGTCGGTCCCTCGAGAGTC
CGGACGCTCGGTCCCGGCGGCCGCAAGGACCGAGCCGTCTCCGTACTGCCCGAGGAGGACCGCAAAAACCCGGGC
GCCATGCCACGGAGACATACCATGCCGCATTCAGACAAGTCGCGCATCGCCTACACGTCGTCCGGACGGAGGAGG
CGGGCGACTTCGGGCTCGGCACGGCCCTTTCTCCGCCTGACGCAGACGCAGGCAACACGCAGGAAGTGGCTCTAC
GCGCTCTACGTCTACGCGTGCCTGCTGGCCATCATCTTGGTCGGCGTCCGCACCCACGTGCAAAGGTACGCGCTC
GGCGGCCACGAGCCCATCGGCTGGGGCTTGGGCTACGTCCTAGGAGACTGGCCGTGGTTCCGTTTCCAGGTGGTC
CAGGCCAATCTCGAGCGCTGGATCTGCCTGACGGAGCTGGCGGGGCGGCACGACGGCCGGGTGCAGCGCCTCCGG
CTCGTCGTCTGGGGCGAGGCGAATACGAGGCTGCTCCTGGGCGGGTACTGGCTCGCCATCCTCGTCGTCGGCCTG
ATGATTGTGTTTCGGCTCAAGGAGATGTACGAGGTGGACACGCGGCGGAAGGTGTTTCACTTCATGATGGTTGGT
ATGTTCCTCCCAGGCACCTACGTCGATCCGGCCTTTGCAGCCCTGGCGCTATCCCTGGTCCTGGCCATTTTTCTC
ATCCTGGACCTGCTGCGGGCGAGCCAGCTGCCTCCGCTGTCGAAGCCCATCGCCTCCTTTCTGGCGCCCTACGTG
GACGGGAGAGACTTTCGAGGCTCGGTCGTGGTATCGCACATATTTTTGCTCATCGGATGCGCCATACCACTGTGG
CTGGCTCTCGCCACGGTGCCTCGGACGGGGACGGCATGCCGAGCCGGCTGGGAGGTGCCGACGAGGGAGGTGAGC
ATGGTGTCGGGCGTCGTCTGTGTCGGCCTCGGCGACGCGGCCGCCTCCCTCATCGGTCGCCGTTACGGGCACCGC
AAGTGGCTTTGGGGCGGCGGAAAGAGCCTCGAAGGGAGCGCTGCGTTTGCCGTCGCCGTTTTCGTCGGCTTGGCC
GTCGCGAGCGCCTGGCTTCGGGCTGGGGGATGGCCAGCGACGGAGGCTGCTATCGGGCCGCTGGCGAGCGCGCGG
AATGCCGCCGTGTGCGCTTCTGTGGCCAGCATGACCGAGGCGGTCCTGACGGGCGGCAACGACAACGTCATTGTG
CCTGTCGTGCTCTGGACCTGCGTCAAGAGTCTCGGCGTCTAA
Gene >Ophio5|1410
ATGCCGGAGCCTTCCTCCTCCTCCACCGACGAGGTCTCGACCGCTCCTAAGACTGACGAGGCCTCGGCCATTCTA
AAGCCCGACGACCAGCGACCCTATCGCACCCTGAGCCGCTCCCCACACCCCTACCACCACCAGACTGCCGAGAGA
TGCGTCCTCGACAACCATCCATCTCCGCCGCGCCACCAGACGCCACCACACTTTACCAAGGACTCGTCTCCAGCC
AGCGAGAGCGGCACCGACGCCGACGACGAGCACTTCCTCAAAGGTCTTCCTGCGCCCCGCGTGAGGTTGCACAAG
GGGCTACGCGGCCAGAACGAGTTCTTATCGCGTCCCTTTACGCCCCTGTCCTATCCTGCCTCTTCTCAAGATGAG
CTACCGCCGCCCGTCGTCGAGCAGAGCCTCGTCGAAACTCGCGTCTCTTTTGGCTGCCGCTTGCGAGACGCCACA
TTTCGCAACAAAGTCCTGATTCGGCGCGCGACGGAGCTGTGCCTCGTCGCGTCGCTGGGGCGCATAGTGCGCTCC
AACGCTCACGTCTCCTTGTTATTGAGCGTCTGGCGCCGAGGTAGGCTTTTGCTCTTTCCGCTGTCACCTGTCAAT
CTTGGTCTTACTGTAATTAGAATTTCAGCTTCTGGGCCTGCTGCTCGCCGCCTTACTGGCTCTTCATCCCCTTCG
TGTCCTCGCATGGGCCTACCGCCGCCATCGCCCATCGCGGTTATTACCTTTTAAAATCCCGTCCGACTTCGATCC
GGCACCTCTGCTGTACCCACCAGCCATCACTGTTTTTGCATCACTCCTGATTTCCGTCGGAAACCCCGCCGTTCT
TCTCCCCAACATCATTCTCAGCATATGCGCATTACCGCGTTCATTGATCCCAACCATTGAGCCCGCCGCTCCCTT
TGATATCCCCCATTGGCTCGTCTCAGGCCTGCCTCTCATATGGACTTCATCCGGTACAACACACTCGGCCCGACA
AGGTTTGGCGGGGGAGACGCTCGTCTTGCTGCATCCACTGCACCAGACGTTGTGCTCCGTCTTGCAACATCTCAC
GACCACAAGCCTCCTGGAAGCCGAGCTTCAGCTGCTTTCGGTTGCCTTGATTAACATTCTCATCTTAGCCGTCTC
GCCTCAGATTGAGGTGCTCAAGGCACTGCTCTGGGTGGGGGGCCTGTCAGCCATCGTGTTTTGTGGTCCGGTCAT
AACGTGGGGGATCTCCCTGGCGCGGGTTCCCAAATGGCGTTTTCGAAAGGCTTTTGACCGTCGGAAGGACGCGCG
CCGGCTTCTGTCGTGGCGCAGAGCCAGAAAGGGATTCCTTGGGCTGTTTAGAGGTGACGGCTTCGACGAGTTCAA
CTCGTCATCTGAGGACGACGAGAGCTCGTCCCGCTTCGTCGGTCCCTCGAGAGTCCGGACGCTCGGTCCCGGCGG
CCGCAAGGACCGAGCCGTCTCCGTACTGCCCGAGGAGGACCGCAAAAACCCGGGCGCCATGCCACGGAGACATAC
CATGCCGCATTCAGACAAGTCGCGCATCGCCTACACGTCGTCCGGACGGAGGAGGCGGGCGACTTCGGGCTCGGC
ACGGCCCTTTCTCCGCCTGACGCAGACGCAGGCAACACGCAGGAAGTGGCTCTACGCGCTCTACGTCTACGCGTG
CCTGCTGGCCATCATCTTGGTCGGCGTCCGCACCCACGTGCAAAGGTACGCGCTCGGCGGCCACGAGCCCATCGG
CTGGGGCTTGGGCTACGTCCTAGGAGACTGGCCGTGGTTCCGTTTCCAGGTGGTCCAGGCCAATCTCGAGCGCTG
GATCTGCCTGACGGAGCTGGCGGGGCGGCACGACGGCCGGGTGCAGCGCCTCCGGCTCGTCGTCTGGGGCGAGGC
GAATACGAGGCTGCTCCTGGGCGGGTACTGGCTCGCCATCCTCGTCGTCGGCCTGATGATTGTGTTTCGGCTCAA
GGAGATGTACGAGGTGGACACGCGGCGGAAGGTGTTTCACTTCATGATGGTTGGTATGTTCCTCCCAGGCACCTA
CGTCGATCCGGCCTTTGCAGCCCTGGCGCTATCCCTGGTCCTGGCCATTTTTCTCATCCTGGACCTGCTGCGGGC
GAGCCAGCTGCCTCCGCTGTCGAAGCCCATCGCCTCCTTTCTGGCGCCCTACGTGGACGGGAGAGACTTTCGAGG
CTCGGTCGTGGTATCGCACATATTTTTGCTCATCGGATGCGCCATACCACTGTGGCTGGCTCTCGCCACGGTGCC
TCGGACGGGGACGGCATGCCGAGCCGGCTGGGAGGTGCCGACGAGGGAGGTGAGCATGGTGTCGGGCGTCGTCTG
TGTCGGCCTCGGCGACGCGGCCGCCTCCCTCATCGGTCGCCGTTACGGGCACCGCAAGTGGCTTTGGGGCGGCGG
AAAGAGCCTCGAAGGGAGCGCTGCGTTTGCCGTCGCCGTTTTCGTCGGCTTGGCCGTCGCGAGCGCCTGGCTTCG
GGCTGGGGGATGGCCAGCGACGGAGGCTGCTATCGGGCCGCTGGCGAGCGCGCGGAATGCCGCCGTGTGCGCTTC
TGTGGCCAGCATGACCGAGGCGGTCCTGACGGGCGGCAACGACAACGTCATTGTGCCTGTCGTGCTCTGGACCTG
CGTCAAGAGTCTCGGCGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail