Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1407
Gene name
Locationscaffold_1482:10..1287
Strand-
Gene length (bp)1277
Transcript length (bp)1134
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07859 Abhydrolase_3 alpha/beta hydrolase fold 1.1E-24 120 348
PF10340 Say1_Mug180 Steryl acetyl hydrolase 8.1E-12 117 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P18773|EST_ACILW Esterase OS=Acinetobacter lwoffii GN=est PE=3 SV=2 115 371 6.0E-13
sp|Q6P093|ADCL2_HUMAN Arylacetamide deacetylase-like 2 OS=Homo sapiens GN=AADACL2 PE=2 SV=3 108 281 6.0E-11
sp|Q01109|BAH_STRHY Acetyl-hydrolase OS=Streptomyces hygroscopicus GN=bah PE=3 SV=3 109 339 3.0E-10
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN=lip2 PE=1 SV=1 120 216 3.0E-09
sp|Q0P5B7|AAAD_BOVIN Arylacetamide deacetylase OS=Bos taurus GN=AADAC PE=2 SV=1 120 279 2.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P18773|EST_ACILW Esterase OS=Acinetobacter lwoffii GN=est PE=3 SV=2 115 371 6.0E-13
sp|Q6P093|ADCL2_HUMAN Arylacetamide deacetylase-like 2 OS=Homo sapiens GN=AADACL2 PE=2 SV=3 108 281 6.0E-11
sp|Q01109|BAH_STRHY Acetyl-hydrolase OS=Streptomyces hygroscopicus GN=bah PE=3 SV=3 109 339 3.0E-10
sp|P24484|LIP2_MORS1 Lipase 2 OS=Moraxella sp. (strain TA144) GN=lip2 PE=1 SV=1 120 216 3.0E-09
sp|Q0P5B7|AAAD_BOVIN Arylacetamide deacetylase OS=Bos taurus GN=AADAC PE=2 SV=1 120 279 2.0E-06
sp|P9WK85|LIPR_MYCTU Putative acetyl-hydrolase LipR OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lipR PE=1 SV=1 115 209 3.0E-06
sp|P9WK84|LIPR_MYCTO Putative acetyl-hydrolase LipR OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lipR PE=3 SV=1 115 209 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 94.64 51.30 137.98
CcL In ants, during behavior modification 202.98 105.10 300.86
CcD In ants, recently dead 305.42 149.11 461.73

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.097183 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1407
MKPQLSATEKLRLAVRLLTVAPLKLSYYAAQLALFAVRNRLPVRLYVKCATARFALGSLSAREVQYMQPGTEEAY
RSWMKDKARRTPDRVRLEPDVQRLDSADGGAILWMGNRRAASKVVLFFHGGGFCIPAGRGHFEWCWNAYVQTGME
TGVEVAVAFLRYSLSPEARFPVQLRQQVAALKAILASGLPPSDIIIGGDSAGGNLVTQLLGHILHPHPDVDSIQL
SRPLAGAFAVSPWLSCDTNMRGFRENGRSDMLCAQSIQSLALTYFGSEAALHSAQRGQNGWVLPMDADETWLLGV
DALVSSLYVTAGSREVLVDDARWLVRALKAANCEVLFHEAGGEAHDFVLLEGDVAEVGEATKRIKEWFRSVIVSR
TG
Coding >Ophio5|1407
ATGAAGCCGCAACTGTCGGCGACGGAGAAGCTCAGGTTGGCCGTCCGCCTGCTGACCGTGGCGCCTTTGAAACTC
TCCTACTACGCCGCCCAGCTCGCCCTGTTCGCGGTCCGGAACCGGCTCCCGGTGCGTCTTTACGTCAAATGCGCC
ACCGCCCGCTTCGCCCTGGGCTCTCTGTCTGCCCGGGAGGTGCAGTACATGCAGCCCGGGACGGAAGAGGCGTAC
AGGTCCTGGATGAAGGACAAGGCCCGGCGGACGCCAGACCGGGTCCGGCTCGAACCGGACGTGCAACGCCTGGAT
TCGGCCGACGGCGGTGCCATTCTCTGGATGGGGAACCGTCGAGCGGCCTCCAAGGTGGTGCTCTTCTTCCACGGC
GGCGGCTTCTGCATCCCCGCGGGCCGTGGCCACTTTGAATGGTGCTGGAACGCGTACGTGCAGACGGGCATGGAA
ACGGGCGTCGAGGTCGCCGTCGCCTTTCTGCGCTACTCGCTTTCGCCCGAGGCCAGATTCCCCGTCCAGCTCCGG
CAGCAGGTAGCAGCCCTCAAAGCCATTCTCGCGTCGGGACTACCGCCGAGCGACATCATCATCGGCGGAGACTCA
GCCGGCGGTAACCTAGTGACGCAACTACTGGGTCACATTCTTCACCCGCACCCCGACGTCGACAGCATCCAACTA
TCAAGACCTCTAGCCGGCGCCTTTGCCGTCTCGCCCTGGCTCAGCTGCGACACCAACATGCGAGGATTCCGAGAG
AACGGTAGGAGCGACATGCTCTGCGCCCAAAGCATCCAGAGTCTCGCCCTGACGTACTTTGGCTCCGAGGCTGCG
CTGCACAGCGCGCAGAGGGGACAGAACGGGTGGGTGCTTCCGATGGATGCGGACGAGACCTGGTTGCTCGGTGTC
GATGCCCTGGTCTCGTCCTTGTACGTCACGGCTGGCAGCAGAGAGGTTCTCGTCGACGATGCTAGGTGGCTGGTG
CGAGCGCTCAAGGCGGCAAACTGTGAGGTGCTCTTTCATGAGGCAGGCGGGGAGGCTCACGACTTTGTTCTCTTG
GAGGGTGACGTGGCCGAGGTCGGAGAGGCGACGAAGCGGATCAAGGAATGGTTCCGATCTGTTATTGTATCGCGT
ACCGGA
Transcript >Ophio5|1407
ATGAAGCCGCAACTGTCGGCGACGGAGAAGCTCAGGTTGGCCGTCCGCCTGCTGACCGTGGCGCCTTTGAAACTC
TCCTACTACGCCGCCCAGCTCGCCCTGTTCGCGGTCCGGAACCGGCTCCCGGTGCGTCTTTACGTCAAATGCGCC
ACCGCCCGCTTCGCCCTGGGCTCTCTGTCTGCCCGGGAGGTGCAGTACATGCAGCCCGGGACGGAAGAGGCGTAC
AGGTCCTGGATGAAGGACAAGGCCCGGCGGACGCCAGACCGGGTCCGGCTCGAACCGGACGTGCAACGCCTGGAT
TCGGCCGACGGCGGTGCCATTCTCTGGATGGGGAACCGTCGAGCGGCCTCCAAGGTGGTGCTCTTCTTCCACGGC
GGCGGCTTCTGCATCCCCGCGGGCCGTGGCCACTTTGAATGGTGCTGGAACGCGTACGTGCAGACGGGCATGGAA
ACGGGCGTCGAGGTCGCCGTCGCCTTTCTGCGCTACTCGCTTTCGCCCGAGGCCAGATTCCCCGTCCAGCTCCGG
CAGCAGGTAGCAGCCCTCAAAGCCATTCTCGCGTCGGGACTACCGCCGAGCGACATCATCATCGGCGGAGACTCA
GCCGGCGGTAACCTAGTGACGCAACTACTGGGTCACATTCTTCACCCGCACCCCGACGTCGACAGCATCCAACTA
TCAAGACCTCTAGCCGGCGCCTTTGCCGTCTCGCCCTGGCTCAGCTGCGACACCAACATGCGAGGATTCCGAGAG
AACGGTAGGAGCGACATGCTCTGCGCCCAAAGCATCCAGAGTCTCGCCCTGACGTACTTTGGCTCCGAGGCTGCG
CTGCACAGCGCGCAGAGGGGACAGAACGGGTGGGTGCTTCCGATGGATGCGGACGAGACCTGGTTGCTCGGTGTC
GATGCCCTGGTCTCGTCCTTGTACGTCACGGCTGGCAGCAGAGAGGTTCTCGTCGACGATGCTAGGTGGCTGGTG
CGAGCGCTCAAGGCGGCAAACTGTGAGGTGCTCTTTCATGAGGCAGGCGGGGAGGCTCACGACTTTGTTCTCTTG
GAGGGTGACGTGGCCGAGGTCGGAGAGGCGACGAAGCGGATCAAGGAATGGTTCCGATCTGTTATTGTATCGCGT
ACCGGATGA
Gene >Ophio5|1407
ATGGCACGTCTTTTCTCCCTCTCCAGACCGTGTTTCCCTTCTTCCCCCCCCCTTGACTGACGAGTTCGCTCTATC
GTAGAAGCCGCAACTGTCGGCGACGGAGAAGCTCAGGTTGGCCGTCCGCCTGCTGACCGTGGGTACGAACCGGCC
ATACCCCTCCCTCTCTCCCCCCCCCCAAGTTACTGACAAGAAGATATACTCCAGCGCCTTTGAAACTCTCCTACT
ACGCCGCCCAGCTCGCCCTGTTCGCGGTCCGGAACCGGCTCCCGGTGCGTCTTTACGTCAAATGCGCCACCGCCC
GCTTCGCCCTGGGCTCTCTGTCTGCCCGGGAGGTGCAGTACATGCAGCCCGGGACGGAAGAGGCGTACAGGTCCT
GGATGAAGGACAAGGCCCGGCGGACGCCAGACCGGGTCCGGCTCGAACCGGACGTGCAACGCCTGGATTCGGCCG
ACGGCGGTGCCATTCTCTGGATGGGGAACCGTCGAGCGGCCTCCAAGGTGGTGCTCTTCTTCCACGGCGGCGGCT
TCTGCATCCCCGCGGGCCGTGGCCACTTTGAATGGTGCTGGAACGCGTACGTGCAGACGGGCATGGAAACGGGCG
TCGAGGTCGCCGTCGCCTTTCTGCGCTACTCGCTTTCGCCCGAGGCCAGATTCCCCGTCCAGCTCCGGCAGCAGG
TAGCAGCCCTCAAAGCCATTCTCGCGTCGGGACTACCGCCGAGCGACATCATCATCGGCGGAGACTCAGCCGGCG
GTAACCTAGTGACGCAACTACTGGGTCACATTCTTCACCCGCACCCCGACGTCGACAGCATCCAACTATCAAGAC
CTCTAGCCGGCGCCTTTGCCGTCTCGCCCTGGCTCAGCTGCGACACCAACATGCGAGGATTCCGAGAGAACGGTA
GGAGCGACATGCTCTGCGCCCAAAGCATCCAGAGTCTCGCCCTGACGTACTTTGGCTCCGAGGCTGCGCTGCACA
GCGCGCAGAGGGGACAGAACGGGTGGGTGCTTCCGATGGATGCGGACGAGACCTGGTTGCTCGGTGTCGATGCCC
TGGTCTCGTCCTTGTACGTCACGGCTGGCAGCAGAGAGGTTCTCGTCGACGATGCTAGGTGGCTGGTGCGAGCGC
TCAAGGCGGCAAACTGTGAGGTGCTCTTTCATGAGGCAGGCGGGGAGGCTCACGACTTTGTTCTCTTGGAGGGTG
ACGTGGCCGAGGTCGGAGAGGCGACGAAGCGGATCAAGGAATGGTTCCGATCTGTTATTGTATCGCGTACCGGAT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail