Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1404
Gene name
Locationscaffold_148:35259..38011
Strand+
Gene length (bp)2752
Transcript length (bp)2502
Coding sequence length (bp)2499
Protein length (aa) 833

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03105 SPX SPX domain 6.3E-12 1 38
PF03105 SPX SPX domain 3.7E-26 37 247
PF00939 Na_sulph_symp Sodium:sulfate symporter transmembrane region 1.0E-34 370 823
PF03600 CitMHS Citrate transporter 2.1E-26 404 766

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27514|PHO91_YEAST Low-affinity phosphate transporter PHO91 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO91 PE=1 SV=2 1 832 0.0E+00
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 1 832 0.0E+00
sp|P39535|PHO90_YEAST Low-affinity phosphate transporter PHO90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO90 PE=1 SV=1 206 827 6.0E-152
sp|P25360|PHO87_YEAST Inorganic phosphate transporter PHO87 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO87 PE=1 SV=2 54 826 3.0E-150
sp|Q58086|Y672_METJA Uncharacterized transporter MJ0672 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0672 PE=3 SV=1 396 822 2.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27514|PHO91_YEAST Low-affinity phosphate transporter PHO91 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO91 PE=1 SV=2 1 832 0.0E+00
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 1 832 0.0E+00
sp|P39535|PHO90_YEAST Low-affinity phosphate transporter PHO90 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO90 PE=1 SV=1 206 827 6.0E-152
sp|P25360|PHO87_YEAST Inorganic phosphate transporter PHO87 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHO87 PE=1 SV=2 54 826 3.0E-150
sp|Q58086|Y672_METJA Uncharacterized transporter MJ0672 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0672 PE=3 SV=1 396 822 2.0E-22
sp|Q49YW0|SDCS_STAS1 Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=sdcS PE=3 SV=1 395 784 3.0E-21
sp|Q8LG88|TDT_ARATH Tonoplast dicarboxylate transporter OS=Arabidopsis thaliana GN=TDT PE=2 SV=2 388 813 6.0E-21
sp|Q21339|NAD3_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 3 OS=Caenorhabditis elegans GN=nac-3 PE=2 SV=3 392 784 2.0E-17
sp|Q57486|Y608_HAEIN Uncharacterized transporter HI_0608 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0608 PE=3 SV=1 391 824 1.0E-16
sp|Q2YU56|SDCS_STAAB Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=sdcS PE=3 SV=1 391 833 2.0E-14
sp|Q8NVS5|SDCS_STAAW Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MW2) GN=sdcS PE=3 SV=1 395 833 2.0E-14
sp|Q6G816|SDCS_STAAS Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MSSA476) GN=sdcS PE=3 SV=1 395 833 2.0E-14
sp|Q93655|NAD1_CAEEL Sodium-dependent low-affinity dicarboxylate transporter 1 OS=Caenorhabditis elegans GN=nac-1 PE=2 SV=3 381 784 1.0E-12
sp|Q6GFE0|SDCS_STAAR Sodium-dependent dicarboxylate transporter SdcS OS=Staphylococcus aureus (strain MRSA252) GN=sdcS PE=3 SV=1 395 755 3.0E-11
sp|Q9VVT2|INDY1_DROME Protein I'm not dead yet OS=Drosophila melanogaster GN=Indy PE=1 SV=2 375 572 4.0E-11
sp|Q67BT3|S13A5_MOUSE Solute carrier family 13 member 5 OS=Mus musculus GN=Slc13a5 PE=2 SV=1 374 532 2.0E-09
sp|Q07252|MEMP_CUPNH Membrane protein OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=H16_A0667 PE=3 SV=2 393 814 2.0E-08
sp|Q86YT5|S13A5_HUMAN Solute carrier family 13 member 5 OS=Homo sapiens GN=SLC13A5 PE=1 SV=1 394 541 4.0E-08
sp|Q8CJ44|S13A5_RAT Solute carrier family 13 member 5 OS=Rattus norvegicus GN=Slc13a5 PE=2 SV=1 395 532 1.0E-07
sp|Q8S403|PHO1_ARATH Phosphate transporter PHO1 OS=Arabidopsis thaliana GN=PHO1 PE=2 SV=1 22 295 1.0E-07
sp|Q9UKG4|S13A4_HUMAN Solute carrier family 13 member 4 OS=Homo sapiens GN=SLC13A4 PE=2 SV=2 390 537 6.0E-07
sp|Q8WWT9|S13A3_HUMAN Solute carrier family 13 member 3 OS=Homo sapiens GN=SLC13A3 PE=1 SV=1 379 540 7.0E-07
sp|Q651J5|PHO13_ORYSJ Phosphate transporter PHO1-3 OS=Oryza sativa subsp. japonica GN=PHO1-3 PE=2 SV=1 164 299 1.0E-06
sp|Q91Y63|S13A3_MOUSE Solute carrier family 13 member 3 OS=Mus musculus GN=Slc13a3 PE=1 SV=1 391 548 2.0E-06
sp|Q9Z0Z5|S13A3_RAT Solute carrier family 13 member 3 OS=Rattus norvegicus GN=Slc13a3 PE=2 SV=1 391 540 2.0E-06
sp|Q9JHI4|S13A1_MOUSE Solute carrier family 13 member 1 OS=Mus musculus GN=Slc13a1 PE=2 SV=2 375 541 2.0E-06
sp|Q28615|S13A2_RABIT Solute carrier family 13 member 2 OS=Oryctolagus cuniculus GN=SLC13A2 PE=2 SV=1 391 532 3.0E-06
sp|Q9ES88|S13A2_MOUSE Solute carrier family 13 member 2 OS=Mus musculus GN=Slc13a2 PE=2 SV=1 389 526 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0022857 transmembrane transporter activity Yes
GO:0016020 membrane Yes
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No
GO:0005215 transporter activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0051179 localization No
GO:0006810 transport No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

Domain # Start End Length
1 362 384 22
2 396 418 22
3 451 473 22
4 497 519 22
5 541 560 19
6 581 603 22
7 623 640 17
8 647 669 22
9 679 701 22
10 720 742 22
11 762 784 22
12 804 826 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 26.38 14.24 38.52
CcL In ants, during behavior modification 36.13 18.27 53.98
CcD In ants, recently dead 14.98 7.36 22.59

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.205215 no
SC16a CcD 0.016488 yes
CcL CcD 0.000535 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1404
MKFSHSIQFNAVPDWSSHYIAYSNLKKLIYQLEKTAHQSRSGDFESRPLVGADSPDDVFAAALNVELDKICSFYA
AKQGELLDEVAHLLGDIGNRSHPLEGTAPLRRVVSDGQRGNASRHAATSDDEDGGEDSASDDDETTGLTKSSHAA
FGRNKRLSVGHRQDMASSAEFASSRRLSNVIDCYDEPSLIISPGLHSSAIMLKKRIIGLYVQLCELKSYIQLNRT
GFTKVLKKFDKILFRELKGSYLRTHVDTAYPFRPDTKRLIDDNIAKMEAAYADVVTGGDTGLANKELRSHLREHV
VWERNTVWRDLIGIERRAEAARLGQSLLGQDQGVALQGDGPDGTAALKQFHTPLGRLSLPLWLANGSIPTLFISI
AIFLALLFIPILQKTEQQNCLAMLVFVSILWATETIPLFVTSLLVPFLSIILRVVREEDPDKPAIRLDAQEATHA
IFASMWTPVIMLLLGGFTLAAALSKCTIDKRLATLILSKAGTRPRTVLVANMFVAAFASMLISNVAAPVLCYSII
EPMLRTLPSDSDMSKAIIIGIALASNIGGMLSPIASPQNVVAMGIMEPEPTWLQWFFIVIPVGAVSLFFIWLLLL
VTFQPGKGTAIAPIRPLKEPFTGVQWFVTIVAVVTVGLWCASQNMEGVFGDMGVIAIMPIVLFFGIGILTKEDFN
NFPWTIIILAAGGLSLGKAVRSSGLLHLFAEVVSDNVQDMSLYGILFVFSALILVIATFISHTVAALIFLPLVYD
IGAAMDRPQPNLLVMAGVLMCSAAMGLPTSGFPNMTAIMKEDAAGQRYLRVKHFISRGVPSSIITLVVVMTLGFG
IMEVAGLD
Coding >Ophio5|1404
ATGAAATTCTCCCACAGCATCCAGTTCAACGCTGTCCCAGACTGGAGCAGCCACTACATTGCCTACAGCAACCTC
AAGAAGCTCATCTACCAACTCGAAAAGACCGCTCACCAGAGTCGTTCTGGCGACTTTGAGTCGAGGCCCCTCGTT
GGCGCCGATAGCCCCGATGACGTCTTCGCCGCCGCCCTCAATGTCGAGCTCGACAAGATCTGCTCCTTCTACGCC
GCCAAGCAGGGCGAGCTGCTAGATGAGGTGGCCCATCTCCTCGGCGACATCGGAAATCGGTCACATCCGCTTGAA
GGCACCGCGCCTTTGCGCAGAGTCGTCTCTGATGGCCAACGTGGCAATGCTTCTCGCCATGCCGCCACATCCGAC
GATGAGGATGGCGGCGAAGACAGCGCTAGCGATGACGACGAAACCACCGGCCTCACCAAGTCGAGCCATGCCGCC
TTTGGCCGCAACAAGAGGCTTTCCGTCGGCCATCGCCAGGACATGGCCTCCTCGGCTGAGTTTGCCTCGTCGCGC
AGGCTCAGCAATGTCATCGACTGCTACGACGAGCCTTCCCTCATCATCTCGCCAGGACTGCATTCGTCCGCCATC
ATGCTCAAGAAGCGCATCATCGGCCTCTACGTCCAGTTGTGCGAGCTCAAGTCGTACATTCAACTCAACAGGACC
GGCTTCACAAAGGTCCTCAAAAAGTTCGACAAGATTCTTTTCAGGGAGCTCAAGGGCTCCTATCTCCGCACCCAC
GTCGACACGGCATACCCGTTCAGGCCGGATACCAAGAGGCTCATCGACGACAACATTGCCAAGATGGAGGCCGCC
TACGCCGACGTCGTCACAGGAGGTGATACTGGTCTGGCCAACAAGGAGCTGCGCTCCCACCTGCGCGAACACGTC
GTCTGGGAGCGGAACACGGTGTGGAGGGACCTCATCGGCATCGAACGTCGTGCCGAGGCCGCCAGGCTGGGGCAG
TCGTTGCTCGGCCAGGATCAAGGCGTGGCGCTGCAAGGCGATGGCCCTGATGGCACCGCTGCTCTCAAGCAGTTC
CACACGCCCCTTGGCCGCCTCTCGCTACCGTTGTGGCTGGCTAACGGGTCCATCCCCACGCTCTTCATCTCCATT
GCCATCTTTCTTGCCCTTCTCTTCATTCCCATTCTACAGAAGACGGAGCAGCAAAACTGCCTGGCCATGCTCGTC
TTTGTTAGCATCCTCTGGGCCACCGAGACAATACCGCTCTTCGTCACCTCACTACTCGTCCCCTTCCTGTCCATC
ATCCTTAGAGTCGTACGCGAGGAGGACCCCGACAAGCCTGCAATCCGTCTCGACGCTCAAGAGGCCACACACGCC
ATCTTCGCCTCTATGTGGACTCCCGTCATCATGCTGCTGCTCGGCGGCTTCACCCTCGCCGCCGCGCTATCCAAA
TGCACCATTGACAAGCGACTCGCCACGCTCATCCTCAGCAAGGCTGGCACCCGACCTAGGACCGTCCTGGTGGCC
AACATGTTTGTTGCCGCCTTCGCCTCCATGCTCATCAGCAACGTCGCCGCTCCCGTTCTCTGCTACTCCATTATC
GAGCCGATGCTGCGAACGCTGCCTTCGGATTCCGACATGTCCAAGGCAATCATCATCGGCATCGCCCTGGCGTCC
AACATCGGGGGTATGCTCTCTCCCATCGCCTCTCCACAGAACGTGGTGGCCATGGGCATCATGGAGCCCGAACCT
ACCTGGCTGCAGTGGTTTTTCATCGTCATCCCCGTCGGCGCCGTCTCCCTGTTCTTCATCTGGCTTCTCCTCCTC
GTCACCTTCCAGCCCGGCAAGGGCACCGCCATTGCCCCGATTCGGCCGCTCAAGGAACCCTTCACGGGCGTGCAG
TGGTTCGTGACTATCGTTGCCGTCGTCACCGTCGGCCTCTGGTGCGCGAGCCAGAACATGGAGGGCGTCTTCGGC
GACATGGGCGTCATCGCCATCATGCCCATCGTCCTCTTCTTCGGAATTGGCATCCTGACCAAGGAGGATTTCAAC
AACTTTCCCTGGACTATCATCATCCTTGCCGCCGGGGGGCTGTCACTCGGTAAGGCCGTACGATCGTCGGGGCTC
CTGCACCTCTTCGCAGAAGTCGTCTCGGATAACGTCCAGGACATGAGCCTGTACGGAATCCTGTTCGTCTTTTCG
GCCCTGATCCTGGTCATCGCTACCTTTATCAGCCATACCGTCGCGGCGCTCATCTTTCTGCCGCTGGTCTACGAC
ATCGGCGCGGCCATGGACCGACCGCAGCCGAATTTGCTGGTCATGGCCGGCGTTCTTATGTGCAGCGCAGCCATG
GGCTTGCCCACAAGCGGCTTCCCCAACATGACCGCCATCATGAAGGAGGACGCCGCCGGTCAGAGATATTTGCGC
GTGAAGCACTTTATCAGCAGGGGCGTTCCCAGCAGTATCATCACGCTGGTCGTGGTCATGACCCTCGGATTTGGA
ATAATGGAAGTGGCTGGCTTGGAT
Transcript >Ophio5|1404
ATGAAATTCTCCCACAGCATCCAGTTCAACGCTGTCCCAGACTGGAGCAGCCACTACATTGCCTACAGCAACCTC
AAGAAGCTCATCTACCAACTCGAAAAGACCGCTCACCAGAGTCGTTCTGGCGACTTTGAGTCGAGGCCCCTCGTT
GGCGCCGATAGCCCCGATGACGTCTTCGCCGCCGCCCTCAATGTCGAGCTCGACAAGATCTGCTCCTTCTACGCC
GCCAAGCAGGGCGAGCTGCTAGATGAGGTGGCCCATCTCCTCGGCGACATCGGAAATCGGTCACATCCGCTTGAA
GGCACCGCGCCTTTGCGCAGAGTCGTCTCTGATGGCCAACGTGGCAATGCTTCTCGCCATGCCGCCACATCCGAC
GATGAGGATGGCGGCGAAGACAGCGCTAGCGATGACGACGAAACCACCGGCCTCACCAAGTCGAGCCATGCCGCC
TTTGGCCGCAACAAGAGGCTTTCCGTCGGCCATCGCCAGGACATGGCCTCCTCGGCTGAGTTTGCCTCGTCGCGC
AGGCTCAGCAATGTCATCGACTGCTACGACGAGCCTTCCCTCATCATCTCGCCAGGACTGCATTCGTCCGCCATC
ATGCTCAAGAAGCGCATCATCGGCCTCTACGTCCAGTTGTGCGAGCTCAAGTCGTACATTCAACTCAACAGGACC
GGCTTCACAAAGGTCCTCAAAAAGTTCGACAAGATTCTTTTCAGGGAGCTCAAGGGCTCCTATCTCCGCACCCAC
GTCGACACGGCATACCCGTTCAGGCCGGATACCAAGAGGCTCATCGACGACAACATTGCCAAGATGGAGGCCGCC
TACGCCGACGTCGTCACAGGAGGTGATACTGGTCTGGCCAACAAGGAGCTGCGCTCCCACCTGCGCGAACACGTC
GTCTGGGAGCGGAACACGGTGTGGAGGGACCTCATCGGCATCGAACGTCGTGCCGAGGCCGCCAGGCTGGGGCAG
TCGTTGCTCGGCCAGGATCAAGGCGTGGCGCTGCAAGGCGATGGCCCTGATGGCACCGCTGCTCTCAAGCAGTTC
CACACGCCCCTTGGCCGCCTCTCGCTACCGTTGTGGCTGGCTAACGGGTCCATCCCCACGCTCTTCATCTCCATT
GCCATCTTTCTTGCCCTTCTCTTCATTCCCATTCTACAGAAGACGGAGCAGCAAAACTGCCTGGCCATGCTCGTC
TTTGTTAGCATCCTCTGGGCCACCGAGACAATACCGCTCTTCGTCACCTCACTACTCGTCCCCTTCCTGTCCATC
ATCCTTAGAGTCGTACGCGAGGAGGACCCCGACAAGCCTGCAATCCGTCTCGACGCTCAAGAGGCCACACACGCC
ATCTTCGCCTCTATGTGGACTCCCGTCATCATGCTGCTGCTCGGCGGCTTCACCCTCGCCGCCGCGCTATCCAAA
TGCACCATTGACAAGCGACTCGCCACGCTCATCCTCAGCAAGGCTGGCACCCGACCTAGGACCGTCCTGGTGGCC
AACATGTTTGTTGCCGCCTTCGCCTCCATGCTCATCAGCAACGTCGCCGCTCCCGTTCTCTGCTACTCCATTATC
GAGCCGATGCTGCGAACGCTGCCTTCGGATTCCGACATGTCCAAGGCAATCATCATCGGCATCGCCCTGGCGTCC
AACATCGGGGGTATGCTCTCTCCCATCGCCTCTCCACAGAACGTGGTGGCCATGGGCATCATGGAGCCCGAACCT
ACCTGGCTGCAGTGGTTTTTCATCGTCATCCCCGTCGGCGCCGTCTCCCTGTTCTTCATCTGGCTTCTCCTCCTC
GTCACCTTCCAGCCCGGCAAGGGCACCGCCATTGCCCCGATTCGGCCGCTCAAGGAACCCTTCACGGGCGTGCAG
TGGTTCGTGACTATCGTTGCCGTCGTCACCGTCGGCCTCTGGTGCGCGAGCCAGAACATGGAGGGCGTCTTCGGC
GACATGGGCGTCATCGCCATCATGCCCATCGTCCTCTTCTTCGGAATTGGCATCCTGACCAAGGAGGATTTCAAC
AACTTTCCCTGGACTATCATCATCCTTGCCGCCGGGGGGCTGTCACTCGGTAAGGCCGTACGATCGTCGGGGCTC
CTGCACCTCTTCGCAGAAGTCGTCTCGGATAACGTCCAGGACATGAGCCTGTACGGAATCCTGTTCGTCTTTTCG
GCCCTGATCCTGGTCATCGCTACCTTTATCAGCCATACCGTCGCGGCGCTCATCTTTCTGCCGCTGGTCTACGAC
ATCGGCGCGGCCATGGACCGACCGCAGCCGAATTTGCTGGTCATGGCCGGCGTTCTTATGTGCAGCGCAGCCATG
GGCTTGCCCACAAGCGGCTTCCCCAACATGACCGCCATCATGAAGGAGGACGCCGCCGGTCAGAGATATTTGCGC
GTGAAGCACTTTATCAGCAGGGGCGTTCCCAGCAGTATCATCACGCTGGTCGTGGTCATGACCCTCGGATTTGGA
ATAATGGAAGTGGCTGGCTTGGATTGA
Gene >Ophio5|1404
ATGAAATTCTCCCACAGCATCCAGTTCAACGCTGTCCCAGACTGGAGCAGCCACTACATTGCCTACAGCAACCTC
AAGAAGCTGTTCGTCACTCGTCCTTGGTACCGCTGCCGTTCCTCCCCGCTGATTCTGTGCCTTGGCAGCATCTAC
CAACTCGAAAAGACCGCTCACCAGAGTCGTTCTGGCGACTTTGAGTCGAGGCCCCTCGTTGGCGCCGATAGCCCC
GATGACGTCTTCGCCGCCGCCCTCAATGTCGAGCTCGACAAGATCTGCTCCTTCTACGCCGCCAAGCAGGGCGAG
CTGCTAGATGAGGTGGCCCATCTCCTCGGCGACATCGGAAATCGGTCACATCCGCTTGAAGGCACCGCGCCTTTG
CGCAGAGTCGTCTCTGATGGCCAACGTGGCAATGCTTCTCGCCATGCCGCCACATCCGACGATGAGGATGGCGGC
GAAGACAGCGCTAGCGATGACGACGAAACCACCGGCCTCACCAAGTCGAGCCATGCCGCCTTTGGCCGCAACAAG
AGGCTTTCCGTCGGCCATCGCCAGGACATGGCCTCCTCGGCTGAGTTTGCCTCGTCGCGCAGGCTCAGCAATGTC
ATCGACTGCTACGACGAGCCTTCCCTCATCATCTCGCCAGGACTGCATTCGTCCGCCATCATGCTCAAGAAGCGC
ATCATCGGCCTCTACGTCCAGTTGTGCGAGCTCAAGTCGTACATTCAACTCAACAGGACCGGCTTCACAAAGGTC
CTCAAAAAGTTCGACAAGATTCTTTTCAGGGAGCTCAAGGGCTCCTATCTCCGCACCCACGTCGACACGGCATAC
CCGTTCAGGCCGGATACCAAGAGGCTCATCGACGACAACATTGCCAAGATGGAGGCCGCCTACGCCGACGTCGTC
ACAGGAGGTGATACTGGTCTGGCCAACAAGGAGCTGCGCTCCCACCTGCGCGAACACGTCGTCTGGGAGCGGAAC
ACGGTGTGGAGGGACCTCATCGGCATCGAACGTCGTGCCGAGGCCGCCAGGCTGGGGCAGTCGTTGCTCGGCCAG
GATCAAGGCGTGGCGCTGCAAGGCGATGGCCCTGATGGCACCGCTGCTCTCAAGCAGTTCCACACGCCCCTTGGC
CGCCTCTCGCTACCGTTGTGGCTGGCTAACGGGTCCATCCCCACGCTCTTCATCTCCATTGCCATCTTTCTTGCC
CTTCTCTTCATTCCCATTCTACAGAAGACGGAGCAGCAAAACTGCCTGGCCATGCTCGTCTTTGTTAGCATCCTC
TGGGCCACCGAGGTGAGTTTCGGCCGCCCCTGAACGCTCGTCTCGTCCTTTCTCCTAAACCCCCCCCGTCTTCAC
AGACAATACCGCTCTTCGTCACCTCACTACTCGTCCCCTTCCTGTCCATCATCCTTAGAGTCGTACGCGAGGAGG
ACCCCGACAAGCCTGCAATCCGTCTCGACGCTCAAGAGGCCACACACGCCATCTTCGCCTCTATGTGGACTCCCG
TCATCATGCTGCTGCTCGGCGGCTTCACCCTCGCCGCCGCGCTATCCAAATGCACCATTGACAAGCGACTCGCCA
CGCTCATCCTCAGCAAGGCTGGCACCCGACCTAGGACCGTCCTGGTGGCCAACATGTTTGTTGCCGCCTTCGCCT
CCATGCTCATCAGCAACGTCGCCGCTCCCGTTCTCTGCTACTCCATTATCGAGGTAGGCCTGCACGCAACGCGCC
CGTCTCACGCAGACAGACGACTGTACTGACTTTCCTCTTAGCCGATGCTGCGAACGCTGCCTTCGGATTCCGACA
TGTCCAAGGCAATCATCATCGGCATCGCCCTGGCGTCCAACATCGGGGGTATGCTCTCTCCCATCGCCTCTCCAC
AGAACGTGGTGGCCATGGGCATCATGGAGCCCGAACCTACCTGGCTGCAGTGGTTTTTCATCGTCATCCCCGTCG
GCGCCGTCTCCCTGTTCTTCATCTGGCTTCTCCTCCTCGTCACCTTCCAGCCCGGCAAGGGCACCGCCATTGCCC
CGATTCGGCCGCTCAAGGAACCCTTCACGGGCGTGCAGTGGTTCGTGACTATCGTTGCCGTCGTCACCGTCGGCC
TCTGGTGCGCGAGCCAGAACATGGAGGGCGTCTTCGGCGACATGGGCGTCATCGCCATCATGCCCATCGTCCTCT
TCTTCGGAATTGGCATCCTGACCAAGGAGGATTTCAACAACTTTCCCTGGACTATCATCATCCTTGCCGCCGGGG
GGCTGTCACTCGGTAAGGCCGTACGATCGTCGGGGCTCCTGCACCTCTTCGCAGAAGTCGTCTCGGATAACGTCC
AGGACATGAGCCTGTACGGAATCCTGTTCGTCTTTTCGGCCCTGATCCTGGTCATCGCTACCTTTATCAGCCATA
CCGTCGCGGCGCTCATCTTTCTGCCGCTGGTCTACGACATCGGCGCGGCCATGGACCGACCGCAGCCGAATTTGC
TGGTCATGGCCGGCGTTCTTATGTGCAGCGCAGCCATGGGCTTGCCCACAAGCGGCTTCCCCAACATGAGTAGGT
TCCCCCCTTGACGACAGCTCCCTTCCCAAGGTACAAAAGACTTAACGGAATCATAGCCGCCATCATGAAGGAGGA
CGCCGCCGGTCAGAGATATTTGCGCGTGAAGCACTTTATCAGCAGGGGCGTTCCCAGCAGTATCATCACGCTGGT
CGTGGTCATGACCCTCGGATTTGGAATAATGGAAGTGGCTGGCTTGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail