Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1393
Gene name
Locationscaffold_148:6410..8561
Strand+
Gene length (bp)2151
Transcript length (bp)2151
Coding sequence length (bp)2148
Protein length (aa) 716

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.3071 0.9098 0.079 0.019 0.0386 0.0209 0.0311 0.0104 0.0208 0.0111

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup2058
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|3337
Ophiocordyceps australis map64 (Brazil) OphauB2|2518
Ophiocordyceps camponoti-floridani Ophcf2|04298
Ophiocordyceps camponoti-rufipedis Ophun1|2115
Ophiocordyceps kimflemingae Ophio5|1393 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2372

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1393
MVATRKSARSEIRSARRQNPGRTSRSLPRRRPQPSCPSSYSDQTESDHDADFQLIDDASAILTANSTCFRNQRVR
KRRSRLANVEFNAKVSPGSGPSREGGSKSGRSSQEPPAKSRKLSKEQGSDESTSVIPDWKDPRISFDCWTDIFFY
AASSVATDDLATNWLIQAATSCRALSEPALTALYRCPPVRTSSKARRLAALLERPPSETLYNYRAKVEALHINIQ
LVPQAVLYQLIHPLRRLKELLIFTPMDQPPYRELDKNLRWHYTEDIFRSLAPAEVDSSEVHVKPYPTLLESWEWS
GRFIGGCVPTAVSMASIHDTTSFSSLTKLSFTNLQLPSLSNLRLKPDSDEEELRAYHEDGRVIEDVAHAISRLKY
LNHLVFESSTVMNDRLLPLLPKNLAHLELINCWEVKSEDLAEFLGTHGSKLRTLVLLHNQSLDLAFLTTLSETCP
GLRELHINLSYYRHHECVNDADPMYDQALLPSQVPKWPSSLRVLSVEHIRNWSVEAAEVFFRSLINSAGDLPNLR
HLAIKTRLDIPWQARATMRREWRATMEKVFLRPVASPRPQASLRAPIMNDVDLPAPKKRSARTAASPPPRRSGRI
AAHVGCRTSAANKRLCRQQGKPSYRDPDTDEDEDEAELTEEDDDAEADNVTAADADGEEGELIIQGLCDTVNLQF
DNQKVRELQYGMEDFLDEDKAETEDEWEEDDEEDESVVVFH
Coding >Ophio5|1393
ATGGTGGCTACCCGAAAGTCGGCACGATCCGAAATCCGGAGTGCTCGTCGTCAAAATCCTGGCCGCACCTCTCGC
TCCTTGCCGCGACGTCGACCACAACCATCATGTCCATCTTCATACAGCGACCAGACCGAATCTGATCATGACGCT
GATTTTCAGCTGATCGACGACGCTTCTGCTATCCTCACAGCCAATTCAACCTGCTTCAGGAATCAACGCGTTAGA
AAACGTCGCTCGCGTCTAGCAAATGTCGAGTTCAACGCCAAGGTCTCACCCGGCTCGGGGCCGTCTCGAGAAGGT
GGCAGCAAGTCTGGACGAAGTTCACAGGAGCCGCCAGCGAAGAGCCGCAAGCTATCCAAGGAGCAAGGCAGTGAC
GAATCAACAAGTGTGATACCGGACTGGAAAGATCCGCGAATATCCTTCGATTGCTGGACCGACATATTCTTCTAC
GCTGCGAGCTCAGTGGCGACCGACGATCTTGCCACAAACTGGCTCATCCAAGCCGCCACGTCTTGCCGCGCTTTG
TCCGAGCCGGCGTTGACGGCGCTGTACCGGTGCCCCCCAGTCAGGACTTCCTCAAAAGCCAGGCGTCTCGCCGCA
TTGCTTGAACGCCCTCCATCGGAAACTCTCTACAATTACCGAGCCAAGGTCGAGGCTCTTCACATCAATATTCAA
CTTGTTCCCCAGGCTGTCTTGTACCAGTTGATTCATCCTCTACGTCGCCTCAAGGAGCTGCTCATCTTCACTCCA
ATGGACCAGCCGCCATACAGAGAGCTTGACAAGAATCTTCGGTGGCACTACACTGAAGATATCTTCCGCTCGCTA
GCCCCTGCGGAAGTGGACTCGAGTGAGGTTCACGTCAAGCCCTATCCCACACTGCTCGAGAGTTGGGAGTGGAGT
GGGAGGTTCATAGGTGGATGCGTTCCCACCGCCGTCTCCATGGCCTCGATCCATGACACAACGTCGTTCTCCTCA
CTCACGAAACTGAGCTTTACCAACCTTCAATTGCCGTCACTGAGCAATCTGCGGCTCAAGCCAGACAGCGACGAG
GAGGAGCTGCGGGCTTACCACGAGGACGGTCGGGTAATCGAGGACGTTGCTCATGCCATATCGCGGTTGAAATAT
CTCAACCACCTGGTCTTCGAGTCCTCGACAGTAATGAATGACCGCCTGCTCCCTCTCTTGCCTAAGAATCTCGCC
CATTTAGAGCTCATTAACTGCTGGGAAGTCAAGTCCGAGGACCTCGCAGAGTTCCTCGGCACGCACGGCAGCAAG
CTTCGAACGCTGGTCTTGCTGCATAACCAATCTCTGGACCTGGCGTTCTTGACCACATTGTCCGAGACTTGCCCC
GGCCTCCGAGAACTACACATAAACTTGTCGTACTACCGTCATCACGAATGCGTCAACGATGCGGACCCCATGTAC
GACCAAGCTCTTCTCCCTTCTCAAGTTCCGAAATGGCCGTCCAGTCTCCGTGTGCTGAGCGTCGAGCACATACGA
AACTGGTCGGTCGAGGCAGCAGAGGTCTTCTTCCGATCTCTAATCAACAGCGCCGGAGACCTGCCCAACCTGCGT
CACCTGGCCATCAAGACCAGGCTCGACATACCCTGGCAAGCCCGTGCGACGATGCGTCGCGAGTGGCGCGCGACC
ATGGAAAAAGTCTTCCTCCGTCCCGTGGCCAGCCCAAGACCGCAGGCCAGTCTGCGGGCGCCAATCATGAACGAC
GTCGATCTGCCGGCGCCAAAGAAGCGTAGTGCGAGGACGGCAGCCAGTCCACCGCCTCGCCGGAGTGGGAGGATT
GCCGCCCACGTTGGCTGTCGCACGTCGGCAGCAAACAAGCGTCTTTGCCGTCAGCAAGGAAAGCCTTCGTACAGG
GACCCGGACACGGACGAGGACGAGGACGAGGCAGAGCTGACGGAGGAGGACGATGACGCAGAGGCCGACAACGTG
ACTGCCGCGGACGCTGATGGCGAAGAGGGCGAGTTGATCATCCAGGGGTTGTGCGACACGGTCAACCTCCAGTTT
GACAACCAGAAAGTCCGGGAGCTGCAGTACGGCATGGAAGACTTCCTCGACGAGGACAAGGCCGAGACGGAGGAC
GAATGGGAGGAAGACGACGAGGAAGACGAGTCCGTCGTCGTCTTTCAC
Transcript >Ophio5|1393
ATGGTGGCTACCCGAAAGTCGGCACGATCCGAAATCCGGAGTGCTCGTCGTCAAAATCCTGGCCGCACCTCTCGC
TCCTTGCCGCGACGTCGACCACAACCATCATGTCCATCTTCATACAGCGACCAGACCGAATCTGATCATGACGCT
GATTTTCAGCTGATCGACGACGCTTCTGCTATCCTCACAGCCAATTCAACCTGCTTCAGGAATCAACGCGTTAGA
AAACGTCGCTCGCGTCTAGCAAATGTCGAGTTCAACGCCAAGGTCTCACCCGGCTCGGGGCCGTCTCGAGAAGGT
GGCAGCAAGTCTGGACGAAGTTCACAGGAGCCGCCAGCGAAGAGCCGCAAGCTATCCAAGGAGCAAGGCAGTGAC
GAATCAACAAGTGTGATACCGGACTGGAAAGATCCGCGAATATCCTTCGATTGCTGGACCGACATATTCTTCTAC
GCTGCGAGCTCAGTGGCGACCGACGATCTTGCCACAAACTGGCTCATCCAAGCCGCCACGTCTTGCCGCGCTTTG
TCCGAGCCGGCGTTGACGGCGCTGTACCGGTGCCCCCCAGTCAGGACTTCCTCAAAAGCCAGGCGTCTCGCCGCA
TTGCTTGAACGCCCTCCATCGGAAACTCTCTACAATTACCGAGCCAAGGTCGAGGCTCTTCACATCAATATTCAA
CTTGTTCCCCAGGCTGTCTTGTACCAGTTGATTCATCCTCTACGTCGCCTCAAGGAGCTGCTCATCTTCACTCCA
ATGGACCAGCCGCCATACAGAGAGCTTGACAAGAATCTTCGGTGGCACTACACTGAAGATATCTTCCGCTCGCTA
GCCCCTGCGGAAGTGGACTCGAGTGAGGTTCACGTCAAGCCCTATCCCACACTGCTCGAGAGTTGGGAGTGGAGT
GGGAGGTTCATAGGTGGATGCGTTCCCACCGCCGTCTCCATGGCCTCGATCCATGACACAACGTCGTTCTCCTCA
CTCACGAAACTGAGCTTTACCAACCTTCAATTGCCGTCACTGAGCAATCTGCGGCTCAAGCCAGACAGCGACGAG
GAGGAGCTGCGGGCTTACCACGAGGACGGTCGGGTAATCGAGGACGTTGCTCATGCCATATCGCGGTTGAAATAT
CTCAACCACCTGGTCTTCGAGTCCTCGACAGTAATGAATGACCGCCTGCTCCCTCTCTTGCCTAAGAATCTCGCC
CATTTAGAGCTCATTAACTGCTGGGAAGTCAAGTCCGAGGACCTCGCAGAGTTCCTCGGCACGCACGGCAGCAAG
CTTCGAACGCTGGTCTTGCTGCATAACCAATCTCTGGACCTGGCGTTCTTGACCACATTGTCCGAGACTTGCCCC
GGCCTCCGAGAACTACACATAAACTTGTCGTACTACCGTCATCACGAATGCGTCAACGATGCGGACCCCATGTAC
GACCAAGCTCTTCTCCCTTCTCAAGTTCCGAAATGGCCGTCCAGTCTCCGTGTGCTGAGCGTCGAGCACATACGA
AACTGGTCGGTCGAGGCAGCAGAGGTCTTCTTCCGATCTCTAATCAACAGCGCCGGAGACCTGCCCAACCTGCGT
CACCTGGCCATCAAGACCAGGCTCGACATACCCTGGCAAGCCCGTGCGACGATGCGTCGCGAGTGGCGCGCGACC
ATGGAAAAAGTCTTCCTCCGTCCCGTGGCCAGCCCAAGACCGCAGGCCAGTCTGCGGGCGCCAATCATGAACGAC
GTCGATCTGCCGGCGCCAAAGAAGCGTAGTGCGAGGACGGCAGCCAGTCCACCGCCTCGCCGGAGTGGGAGGATT
GCCGCCCACGTTGGCTGTCGCACGTCGGCAGCAAACAAGCGTCTTTGCCGTCAGCAAGGAAAGCCTTCGTACAGG
GACCCGGACACGGACGAGGACGAGGACGAGGCAGAGCTGACGGAGGAGGACGATGACGCAGAGGCCGACAACGTG
ACTGCCGCGGACGCTGATGGCGAAGAGGGCGAGTTGATCATCCAGGGGTTGTGCGACACGGTCAACCTCCAGTTT
GACAACCAGAAAGTCCGGGAGCTGCAGTACGGCATGGAAGACTTCCTCGACGAGGACAAGGCCGAGACGGAGGAC
GAATGGGAGGAAGACGACGAGGAAGACGAGTCCGTCGTCGTCTTTCACTGA
Gene >Ophio5|1393
ATGGTGGCTACCCGAAAGTCGGCACGATCCGAAATCCGGAGTGCTCGTCGTCAAAATCCTGGCCGCACCTCTCGC
TCCTTGCCGCGACGTCGACCACAACCATCATGTCCATCTTCATACAGCGACCAGACCGAATCTGATCATGACGCT
GATTTTCAGCTGATCGACGACGCTTCTGCTATCCTCACAGCCAATTCAACCTGCTTCAGGAATCAACGCGTTAGA
AAACGTCGCTCGCGTCTAGCAAATGTCGAGTTCAACGCCAAGGTCTCACCCGGCTCGGGGCCGTCTCGAGAAGGT
GGCAGCAAGTCTGGACGAAGTTCACAGGAGCCGCCAGCGAAGAGCCGCAAGCTATCCAAGGAGCAAGGCAGTGAC
GAATCAACAAGTGTGATACCGGACTGGAAAGATCCGCGAATATCCTTCGATTGCTGGACCGACATATTCTTCTAC
GCTGCGAGCTCAGTGGCGACCGACGATCTTGCCACAAACTGGCTCATCCAAGCCGCCACGTCTTGCCGCGCTTTG
TCCGAGCCGGCGTTGACGGCGCTGTACCGGTGCCCCCCAGTCAGGACTTCCTCAAAAGCCAGGCGTCTCGCCGCA
TTGCTTGAACGCCCTCCATCGGAAACTCTCTACAATTACCGAGCCAAGGTCGAGGCTCTTCACATCAATATTCAA
CTTGTTCCCCAGGCTGTCTTGTACCAGTTGATTCATCCTCTACGTCGCCTCAAGGAGCTGCTCATCTTCACTCCA
ATGGACCAGCCGCCATACAGAGAGCTTGACAAGAATCTTCGGTGGCACTACACTGAAGATATCTTCCGCTCGCTA
GCCCCTGCGGAAGTGGACTCGAGTGAGGTTCACGTCAAGCCCTATCCCACACTGCTCGAGAGTTGGGAGTGGAGT
GGGAGGTTCATAGGTGGATGCGTTCCCACCGCCGTCTCCATGGCCTCGATCCATGACACAACGTCGTTCTCCTCA
CTCACGAAACTGAGCTTTACCAACCTTCAATTGCCGTCACTGAGCAATCTGCGGCTCAAGCCAGACAGCGACGAG
GAGGAGCTGCGGGCTTACCACGAGGACGGTCGGGTAATCGAGGACGTTGCTCATGCCATATCGCGGTTGAAATAT
CTCAACCACCTGGTCTTCGAGTCCTCGACAGTAATGAATGACCGCCTGCTCCCTCTCTTGCCTAAGAATCTCGCC
CATTTAGAGCTCATTAACTGCTGGGAAGTCAAGTCCGAGGACCTCGCAGAGTTCCTCGGCACGCACGGCAGCAAG
CTTCGAACGCTGGTCTTGCTGCATAACCAATCTCTGGACCTGGCGTTCTTGACCACATTGTCCGAGACTTGCCCC
GGCCTCCGAGAACTACACATAAACTTGTCGTACTACCGTCATCACGAATGCGTCAACGATGCGGACCCCATGTAC
GACCAAGCTCTTCTCCCTTCTCAAGTTCCGAAATGGCCGTCCAGTCTCCGTGTGCTGAGCGTCGAGCACATACGA
AACTGGTCGGTCGAGGCAGCAGAGGTCTTCTTCCGATCTCTAATCAACAGCGCCGGAGACCTGCCCAACCTGCGT
CACCTGGCCATCAAGACCAGGCTCGACATACCCTGGCAAGCCCGTGCGACGATGCGTCGCGAGTGGCGCGCGACC
ATGGAAAAAGTCTTCCTCCGTCCCGTGGCCAGCCCAAGACCGCAGGCCAGTCTGCGGGCGCCAATCATGAACGAC
GTCGATCTGCCGGCGCCAAAGAAGCGTAGTGCGAGGACGGCAGCCAGTCCACCGCCTCGCCGGAGTGGGAGGATT
GCCGCCCACGTTGGCTGTCGCACGTCGGCAGCAAACAAGCGTCTTTGCCGTCAGCAAGGAAAGCCTTCGTACAGG
GACCCGGACACGGACGAGGACGAGGACGAGGCAGAGCTGACGGAGGAGGACGATGACGCAGAGGCCGACAACGTG
ACTGCCGCGGACGCTGATGGCGAAGAGGGCGAGTTGATCATCCAGGGGTTGTGCGACACGGTCAACCTCCAGTTT
GACAACCAGAAAGTCCGGGAGCTGCAGTACGGCATGGAAGACTTCCTCGACGAGGACAAGGCCGAGACGGAGGAC
GAATGGGAGGAAGACGACGAGGAAGACGAGTCCGTCGTCGTCTTTCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail