Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1392
Gene name
Locationscaffold_148:3015..5221
Strand-
Gene length (bp)2206
Transcript length (bp)2061
Coding sequence length (bp)2058
Protein length (aa) 686

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus Nuclear localization signal 0.2472 0.9454 0.0745 0.0169 0.0665 0.0059 0.0199 0.0107 0.0128 0.0164

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup1978
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2448
Ophiocordyceps australis map64 (Brazil) OphauB2|2517
Ophiocordyceps camponoti-floridani Ophcf2|04297
Ophiocordyceps camponoti-rufipedis Ophun1|2114
Ophiocordyceps kimflemingae Ophio5|1392 (this protein)
Ophiocordyceps subramaniannii Hirsu2|2172

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1392
MGNVMASPMVKGPLPRHVDGSSPSKRRRLTSPDPFDLDRLLASPQMSEPSSALRIDVLKIIHKDSKKVKSFQATT
IPRDFVTTKARCRITIFDTSFGEPQVLHCQSKLCDLVTFKNPVGPHRVARVDLPRPFFVPHESILINRPDDGRFD
LSDSYQLLVELEAADGIPWPPLDSHDFGLSPTLPYPPRDSTQHWILSSRFDSVVGRLKHSLNLSARLSPQHPPYE
TDYVMDVDLRWAAGFKALKHADKDSKPCITAIDPEVHPCRFADFHRPRDTDADGPNGHVNGETSLERDDESILGH
TPSRSLRAREKEKVYNLKLLSDQAQGREKRKRGRSDSVTTVEGRVQYLLPADQPVCLDYFRCVSCESTSQGPQFR
VSALRESFTSSVKPHAFGHQVRPFNLHTVTDDQVFATSRLTLENDACNRFSSSRPPLERLQSGSPALKGPKPGTS
RRSRKQRPTKALVPDIPRPLYHPISKARLKPGDEVPETAPDSTWLIQRHRESIAEFSDVTPAEKEYIWEWDGYIL
GKNLTSLAYFPREWLGFVREKATWLVSEQRRMLEFGKHSSALLARNLLNDTMMEDAFAMIDNAKVALKQQARQGQ
SSASTKQQPAAGVPSPKQSPRVLQIRKSASGCAVCQLPVLGPTTLICSNTSCSRRLYHSTCIMKSILPLPRVNWL
CDACCAIDGSP
Coding >Ophio5|1392
ATGGGCAATGTCATGGCCTCTCCAATGGTCAAGGGTCCGCTTCCACGCCATGTTGATGGCTCGAGTCCGTCCAAG
CGCCGTCGCCTCACGTCTCCCGACCCTTTCGATCTGGACCGTCTCCTCGCCTCGCCCCAGATGTCGGAACCTAGC
TCAGCCCTGCGCATCGACGTGCTCAAGATCATTCACAAGGACTCTAAAAAGGTCAAGTCATTCCAGGCCACGACC
ATCCCTCGCGACTTCGTCACTACCAAGGCCCGCTGCAGGATCACTATTTTCGACACGAGCTTCGGTGAGCCTCAG
GTCCTTCACTGCCAGAGCAAGCTCTGCGACCTGGTAACTTTCAAAAATCCTGTGGGCCCTCATCGCGTCGCCCGC
GTCGATCTGCCGCGTCCTTTCTTTGTTCCCCATGAGAGCATACTCATCAATAGGCCAGATGACGGTAGATTTGAT
CTATCCGACTCTTACCAGCTCCTGGTCGAACTAGAAGCTGCCGACGGCATTCCTTGGCCTCCACTCGACTCACAT
GACTTTGGTCTCTCCCCCACATTGCCTTATCCGCCGCGGGATTCGACCCAGCATTGGATCTTATCAAGCCGCTTC
GACAGCGTCGTCGGCAGGCTGAAGCACTCACTCAATCTGTCGGCCAGGCTATCCCCGCAACATCCACCCTACGAG
ACTGATTATGTCATGGACGTTGACCTTCGATGGGCAGCCGGTTTCAAAGCACTCAAGCACGCGGACAAGGACTCG
AAACCGTGCATCACTGCTATTGATCCCGAGGTCCATCCTTGCCGCTTTGCAGATTTTCATCGCCCGCGAGACACC
GACGCTGACGGCCCAAACGGGCATGTCAACGGAGAAACATCTCTCGAACGGGATGATGAGTCCATACTAGGTCAT
ACGCCATCCCGGTCATTGAGGGCTCGGGAAAAAGAAAAGGTTTACAACTTGAAACTCTTGAGCGACCAGGCCCAA
GGGAGAGAAAAACGAAAACGTGGGAGAAGCGACAGCGTGACGACGGTCGAGGGTCGCGTTCAGTATCTCTTACCG
GCTGATCAACCCGTCTGCCTCGACTATTTTCGCTGTGTCAGCTGCGAGTCAACGAGTCAAGGGCCTCAGTTCCGG
GTCTCTGCCCTGCGTGAATCCTTCACATCTTCCGTCAAACCGCACGCCTTCGGGCACCAGGTGCGGCCCTTCAAC
CTCCACACAGTCACTGATGACCAGGTGTTCGCGACTTCGCGCCTTACCTTGGAAAATGATGCCTGCAACAGGTTT
TCATCGTCCAGACCTCCATTGGAGCGACTTCAATCTGGGTCCCCAGCCTTAAAGGGCCCAAAGCCCGGCACATCA
CGTCGTTCACGGAAGCAGAGGCCTACCAAGGCTTTGGTGCCAGATATTCCTCGACCACTTTACCACCCCATAAGC
AAGGCGCGCCTCAAACCCGGCGACGAGGTGCCGGAGACTGCTCCAGACAGCACGTGGCTAATTCAGAGGCACCGA
GAAAGCATAGCCGAGTTCTCTGACGTGACTCCGGCCGAAAAGGAGTACATTTGGGAATGGGACGGCTACATACTC
GGCAAGAATCTCACATCGCTGGCCTACTTTCCCCGGGAGTGGCTCGGCTTCGTTCGGGAAAAGGCGACGTGGCTC
GTCTCGGAGCAGCGGCGGATGCTGGAATTCGGAAAGCACTCGAGCGCGCTGCTTGCCCGCAACCTTTTGAATGAC
ACGATGATGGAGGACGCCTTCGCCATGATTGATAATGCCAAGGTGGCACTGAAGCAGCAGGCCCGTCAAGGCCAA
TCCAGCGCATCAACCAAACAGCAGCCGGCAGCCGGCGTTCCGAGCCCTAAGCAGTCACCGAGAGTCTTGCAGATC
CGCAAGAGTGCCAGCGGTTGTGCCGTATGCCAGCTACCGGTTCTCGGCCCGACCACGTTGATATGCTCCAATACG
TCCTGCTCCAGACGTCTCTATCACTCCACATGCATCATGAAGTCCATCCTGCCGCTACCTCGAGTGAATTGGCTT
TGTGATGCGTGCTGCGCAATCGATGGGTCGCCT
Transcript >Ophio5|1392
ATGGGCAATGTCATGGCCTCTCCAATGGTCAAGGGTCCGCTTCCACGCCATGTTGATGGCTCGAGTCCGTCCAAG
CGCCGTCGCCTCACGTCTCCCGACCCTTTCGATCTGGACCGTCTCCTCGCCTCGCCCCAGATGTCGGAACCTAGC
TCAGCCCTGCGCATCGACGTGCTCAAGATCATTCACAAGGACTCTAAAAAGGTCAAGTCATTCCAGGCCACGACC
ATCCCTCGCGACTTCGTCACTACCAAGGCCCGCTGCAGGATCACTATTTTCGACACGAGCTTCGGTGAGCCTCAG
GTCCTTCACTGCCAGAGCAAGCTCTGCGACCTGGTAACTTTCAAAAATCCTGTGGGCCCTCATCGCGTCGCCCGC
GTCGATCTGCCGCGTCCTTTCTTTGTTCCCCATGAGAGCATACTCATCAATAGGCCAGATGACGGTAGATTTGAT
CTATCCGACTCTTACCAGCTCCTGGTCGAACTAGAAGCTGCCGACGGCATTCCTTGGCCTCCACTCGACTCACAT
GACTTTGGTCTCTCCCCCACATTGCCTTATCCGCCGCGGGATTCGACCCAGCATTGGATCTTATCAAGCCGCTTC
GACAGCGTCGTCGGCAGGCTGAAGCACTCACTCAATCTGTCGGCCAGGCTATCCCCGCAACATCCACCCTACGAG
ACTGATTATGTCATGGACGTTGACCTTCGATGGGCAGCCGGTTTCAAAGCACTCAAGCACGCGGACAAGGACTCG
AAACCGTGCATCACTGCTATTGATCCCGAGGTCCATCCTTGCCGCTTTGCAGATTTTCATCGCCCGCGAGACACC
GACGCTGACGGCCCAAACGGGCATGTCAACGGAGAAACATCTCTCGAACGGGATGATGAGTCCATACTAGGTCAT
ACGCCATCCCGGTCATTGAGGGCTCGGGAAAAAGAAAAGGTTTACAACTTGAAACTCTTGAGCGACCAGGCCCAA
GGGAGAGAAAAACGAAAACGTGGGAGAAGCGACAGCGTGACGACGGTCGAGGGTCGCGTTCAGTATCTCTTACCG
GCTGATCAACCCGTCTGCCTCGACTATTTTCGCTGTGTCAGCTGCGAGTCAACGAGTCAAGGGCCTCAGTTCCGG
GTCTCTGCCCTGCGTGAATCCTTCACATCTTCCGTCAAACCGCACGCCTTCGGGCACCAGGTGCGGCCCTTCAAC
CTCCACACAGTCACTGATGACCAGGTGTTCGCGACTTCGCGCCTTACCTTGGAAAATGATGCCTGCAACAGGTTT
TCATCGTCCAGACCTCCATTGGAGCGACTTCAATCTGGGTCCCCAGCCTTAAAGGGCCCAAAGCCCGGCACATCA
CGTCGTTCACGGAAGCAGAGGCCTACCAAGGCTTTGGTGCCAGATATTCCTCGACCACTTTACCACCCCATAAGC
AAGGCGCGCCTCAAACCCGGCGACGAGGTGCCGGAGACTGCTCCAGACAGCACGTGGCTAATTCAGAGGCACCGA
GAAAGCATAGCCGAGTTCTCTGACGTGACTCCGGCCGAAAAGGAGTACATTTGGGAATGGGACGGCTACATACTC
GGCAAGAATCTCACATCGCTGGCCTACTTTCCCCGGGAGTGGCTCGGCTTCGTTCGGGAAAAGGCGACGTGGCTC
GTCTCGGAGCAGCGGCGGATGCTGGAATTCGGAAAGCACTCGAGCGCGCTGCTTGCCCGCAACCTTTTGAATGAC
ACGATGATGGAGGACGCCTTCGCCATGATTGATAATGCCAAGGTGGCACTGAAGCAGCAGGCCCGTCAAGGCCAA
TCCAGCGCATCAACCAAACAGCAGCCGGCAGCCGGCGTTCCGAGCCCTAAGCAGTCACCGAGAGTCTTGCAGATC
CGCAAGAGTGCCAGCGGTTGTGCCGTATGCCAGCTACCGGTTCTCGGCCCGACCACGTTGATATGCTCCAATACG
TCCTGCTCCAGACGTCTCTATCACTCCACATGCATCATGAAGTCCATCCTGCCGCTACCTCGAGTGAATTGGCTT
TGTGATGCGTGCTGCGCAATCGATGGGTCGCCTTGA
Gene >Ophio5|1392
ATGGGCAATGTCATGGCCTCTCCAATGGTCAAGGGTCCGCTTCCACGCCATGTTGATGGCTCGAGTCCGTCCAAG
CGCCGTCGCCTCACGTCTCCCGACCCTTTCGATCTGGACCGTCTCCTCGCCTCGCCCCAGATGTCGGAACCTAGC
TCAGCCCTGCGCATCGACGTGCTCAAGATCATTCACAAGGACTCTAAAAAGGTCAAGTCATTCCAGGCCACGACC
ATCCCTCGCGACTTCGTCACTACCAAGGCCCGCTGCAGGATCACTATTTTCGACACGAGCTTCGGTGAGCCTCAG
GTCCTTCACTGCCAGAGCAAGCTCTGCGACCTGGTAACTTTCAAAAATCCTGTGGGCCCTCATCGCGTCGCCCGC
GTCGATCTGCCGCGTCCTTTCTTTGTTCCCCATGAGAGCATACTCATCAATAGGCCAGATGACGGTAGATTTGAT
CTATCCGACTCTTACCAGCTCCTGGTCGAACTAGAAGCTGCCGACGGCATTCCTTGGCCTCCACTCGACTCACAT
GACTTTGGTCTCTCCCCCACATTGCCTTATCCGCCGCGGGATTCGACCCAGCATTGGATCTTATCAAGCCGCTTC
GACAGCGTCGTCGGCAGGCTGAAGCACTCACTCAATCTGTCGGCCAGGCTATCCCCGCAACATCCACCCTACGAG
ACTGATTATGTCATGGACGTTGACCTTCGATGGGCAGCCGGTTTCAAAGCACTCAAGCACGCGGACAAGGACTCG
AAACCGTGCATCACTGCTATTGATCCCGAGGTCCATCCTTGCCGCTTTGCAGATTTTCATCGCCCGCGAGACACC
GACGCTGACGGCCCAAACGGGCATGTCAACGGAGAAACATCTCTCGAACGGGATGATGAGTCCATACTAGGTCAT
ACGCCATCCCGGTCATTGAGGGCTCGGGAAAAAGAAAAGGTTTACAACTTGAAACTCTTGAGCGACCAGGCCCAA
GGGAGAGAAAAACGAAAACGTGGGAGAAGCGACAGCGTGACGACGGTCGAGGGTCGCGTTCAGTATCTCTTACCG
GCTGATCAACCCGTCTGCCTCGACTATTTTCGCTGTGTCAGCTGCGGTGCGTATCATGAGTCCATGGAGCAGTTG
CAAACGCATCTTCGCACCGTTCACACCACCTACGATTATGTGTTAGAGTCAACGAGTCAAGGGCCTCAGTTCCGG
GTCTCTGCCCTGCGTGAATCCTTCACATCTTCCGTCAAACCGCACGCCTTCGGGCACCAGGTGCGGCCCTTCAAC
CTCCACACAGTCACTGATGACCAGGTGTTCGCGACTTCGCGCCTTACCTTGGAAAATGATGCCTGCAACAGGTTT
TCATCGTCCAGACCTCCATTGGAGCGACTTCAATCTGGGTCCCCAGCCTTAAAGGGCCCAAAGCCCGGCACATCA
CGTCGTTCACGGAAGCAGAGGCCTACCAAGGCTTTGGTGCCAGATATTCCTCGACCACTTTACCACCCCATAAGC
AAGGCGCGCCTCAAACCCGGCGACGAGGTGCCGGAGACTGCTCCAGACAGCACGTGGCTAATTCAGAGGCACCGA
GAAAGCATAGCCGAGTTCTCTGACGTGACTCCGGCCGAAAAGGAGTACATTTGGGAATGGGACGGCTACATACTC
GGCAAGAATCTCACATCGCTGGCCTACTTTCCCCGGGAGTGGCTCGGCTTCGTTCGGGAAAAGGCGACGTGGCTC
GTCTCGGAGCAGCGGCGGATGCTGGAATTCGGAAAGCACTCGAGCGCGCTGCTTGCCCGCAACCTTTTGAATGAC
ACGATGATGGAGGACGCCTTCGCCATGATTGATAATGCCAAGGTGGCACTGAAGCAGCAGGCCCGTCAAGGCCAA
TCCAGCGCATCAACCAAACAGCAGCCGGCAGCCGGCGTTCCGAGCCCTAAGCAGTCACCGAGAGTCTTGCAGATC
CGCAAGAGTGCCAGCGGTTGTGCCGTATGCCAGCTACCGGTTCTCGGCCCGACCACGTTGATATGCTCCAATACG
GTGTGGATTTCTCACATCCCTTGCTCCCCCCCCGTCAAGGGAAAGTGTGCTGACATGCTCATTGCTGCAGTCCTG
CTCCAGACGTCTCTATCACTCCACATGCATCATGAAGTCCATCCTGCCGCTACCTCGAGTGAATTGGCTTTGTGA
TGCGTGCTGCGCAATCGATGGGTCGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail