Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1385
Gene name
Locationscaffold_147:29280..30336
Strand-
Gene length (bp)1056
Transcript length (bp)1056
Coding sequence length (bp)1053
Protein length (aa) 351

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05637 Glyco_transf_34 galactosyl transferase GMA12/MNN10 family 2.9E-16 142 309

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P78817|YFE6_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C637.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC637.06 PE=2 SV=2 76 307 2.0E-06
sp|O94622|YBKD_SCHPO Uncharacterized alpha-1,2-galactosyltransferase C1289.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1289.13c PE=3 SV=1 153 306 4.0E-06

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0016757 glycosyltransferase activity Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No
GO:0005575 cellular_component No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1385
MAIFLVYQLFATLDTSSVSPAKTPFHFRQDAKLKSRRLRVYGDDDCVSDIDPWALVPEAVAIRKSCRKSHSALSS
LEMKRPKVATVSAHITKAKNSDRFYQKAIQTHLLHRIVHRSHLKLLCSPLVDALWNKEAFILSILTEELVKPPER
RLEWIFWADRDSVILDYCRDATDFLPRSEVDDSSASAGSPHAKQINLLIANDRNGLNDGTFLLRVGKWAIDLLSD
TLAFPRFKPDVHLTFTEQSAMENLLREDRYKDGVRYVPQHWFNAWPQQEGRSGEYATLDNTTKLDKWAVRRGDFL
VHFAGCSDKEREVTGFTETARQVGNVWESGRALRDVSAEIAEFWSNSSRTP
Coding >Ophio5|1385
ATGGCCATCTTTCTGGTTTATCAACTATTTGCAACACTCGACACCTCCTCTGTCTCTCCCGCCAAAACGCCATTT
CACTTTCGTCAAGATGCAAAACTGAAGTCACGTCGACTACGAGTCTACGGTGACGATGACTGCGTTTCCGATATA
GACCCTTGGGCTCTTGTCCCTGAAGCTGTCGCTATCCGGAAATCTTGTCGAAAATCACACTCGGCCCTAAGCTCA
CTGGAAATGAAGAGGCCGAAAGTTGCAACTGTGAGCGCCCACATTACAAAGGCCAAGAATTCAGACAGATTCTAT
CAAAAGGCCATTCAGACTCACCTCCTGCACCGTATCGTCCATCGTTCACACTTGAAGCTGCTTTGTTCGCCGCTG
GTTGACGCCCTTTGGAATAAAGAAGCTTTTATCCTATCTATTCTAACAGAGGAGTTGGTCAAGCCGCCGGAGAGG
CGCCTAGAATGGATTTTTTGGGCAGATCGAGACAGCGTTATACTCGACTACTGTCGAGATGCCACCGACTTCCTC
CCTCGGTCCGAAGTCGACGATTCCTCCGCCTCTGCAGGGTCACCGCACGCAAAACAGATTAACCTCTTGATAGCC
AACGACCGCAACGGGTTAAATGACGGCACCTTTCTCCTGCGTGTTGGGAAATGGGCCATCGACCTTTTGAGCGAC
ACGCTTGCGTTTCCTCGCTTCAAGCCCGACGTTCACCTGACATTCACGGAGCAAAGCGCGATGGAGAATCTTCTT
CGCGAAGACAGATACAAAGACGGCGTTCGATACGTTCCGCAACACTGGTTCAACGCGTGGCCCCAACAAGAAGGT
CGGTCCGGGGAATACGCAACACTAGATAATACGACAAAGCTGGATAAATGGGCTGTTCGACGAGGTGACTTTCTT
GTGCACTTTGCTGGTTGCTCGGACAAGGAACGTGAGGTCACCGGCTTTACTGAGACTGCACGGCAAGTCGGTAAC
GTGTGGGAATCGGGTCGAGCGTTGAGAGATGTCAGTGCGGAAATTGCAGAGTTCTGGTCGAATAGTTCTCGAACG
CCC
Transcript >Ophio5|1385
ATGGCCATCTTTCTGGTTTATCAACTATTTGCAACACTCGACACCTCCTCTGTCTCTCCCGCCAAAACGCCATTT
CACTTTCGTCAAGATGCAAAACTGAAGTCACGTCGACTACGAGTCTACGGTGACGATGACTGCGTTTCCGATATA
GACCCTTGGGCTCTTGTCCCTGAAGCTGTCGCTATCCGGAAATCTTGTCGAAAATCACACTCGGCCCTAAGCTCA
CTGGAAATGAAGAGGCCGAAAGTTGCAACTGTGAGCGCCCACATTACAAAGGCCAAGAATTCAGACAGATTCTAT
CAAAAGGCCATTCAGACTCACCTCCTGCACCGTATCGTCCATCGTTCACACTTGAAGCTGCTTTGTTCGCCGCTG
GTTGACGCCCTTTGGAATAAAGAAGCTTTTATCCTATCTATTCTAACAGAGGAGTTGGTCAAGCCGCCGGAGAGG
CGCCTAGAATGGATTTTTTGGGCAGATCGAGACAGCGTTATACTCGACTACTGTCGAGATGCCACCGACTTCCTC
CCTCGGTCCGAAGTCGACGATTCCTCCGCCTCTGCAGGGTCACCGCACGCAAAACAGATTAACCTCTTGATAGCC
AACGACCGCAACGGGTTAAATGACGGCACCTTTCTCCTGCGTGTTGGGAAATGGGCCATCGACCTTTTGAGCGAC
ACGCTTGCGTTTCCTCGCTTCAAGCCCGACGTTCACCTGACATTCACGGAGCAAAGCGCGATGGAGAATCTTCTT
CGCGAAGACAGATACAAAGACGGCGTTCGATACGTTCCGCAACACTGGTTCAACGCGTGGCCCCAACAAGAAGGT
CGGTCCGGGGAATACGCAACACTAGATAATACGACAAAGCTGGATAAATGGGCTGTTCGACGAGGTGACTTTCTT
GTGCACTTTGCTGGTTGCTCGGACAAGGAACGTGAGGTCACCGGCTTTACTGAGACTGCACGGCAAGTCGGTAAC
GTGTGGGAATCGGGTCGAGCGTTGAGAGATGTCAGTGCGGAAATTGCAGAGTTCTGGTCGAATAGTTCTCGAACG
CCCTGA
Gene >Ophio5|1385
ATGGCCATCTTTCTGGTTTATCAACTATTTGCAACACTCGACACCTCCTCTGTCTCTCCCGCCAAAACGCCATTT
CACTTTCGTCAAGATGCAAAACTGAAGTCACGTCGACTACGAGTCTACGGTGACGATGACTGCGTTTCCGATATA
GACCCTTGGGCTCTTGTCCCTGAAGCTGTCGCTATCCGGAAATCTTGTCGAAAATCACACTCGGCCCTAAGCTCA
CTGGAAATGAAGAGGCCGAAAGTTGCAACTGTGAGCGCCCACATTACAAAGGCCAAGAATTCAGACAGATTCTAT
CAAAAGGCCATTCAGACTCACCTCCTGCACCGTATCGTCCATCGTTCACACTTGAAGCTGCTTTGTTCGCCGCTG
GTTGACGCCCTTTGGAATAAAGAAGCTTTTATCCTATCTATTCTAACAGAGGAGTTGGTCAAGCCGCCGGAGAGG
CGCCTAGAATGGATTTTTTGGGCAGATCGAGACAGCGTTATACTCGACTACTGTCGAGATGCCACCGACTTCCTC
CCTCGGTCCGAAGTCGACGATTCCTCCGCCTCTGCAGGGTCACCGCACGCAAAACAGATTAACCTCTTGATAGCC
AACGACCGCAACGGGTTAAATGACGGCACCTTTCTCCTGCGTGTTGGGAAATGGGCCATCGACCTTTTGAGCGAC
ACGCTTGCGTTTCCTCGCTTCAAGCCCGACGTTCACCTGACATTCACGGAGCAAAGCGCGATGGAGAATCTTCTT
CGCGAAGACAGATACAAAGACGGCGTTCGATACGTTCCGCAACACTGGTTCAACGCGTGGCCCCAACAAGAAGGT
CGGTCCGGGGAATACGCAACACTAGATAATACGACAAAGCTGGATAAATGGGCTGTTCGACGAGGTGACTTTCTT
GTGCACTTTGCTGGTTGCTCGGACAAGGAACGTGAGGTCACCGGCTTTACTGAGACTGCACGGCAAGTCGGTAAC
GTGTGGGAATCGGGTCGAGCGTTGAGAGATGTCAGTGCGGAAATTGCAGAGTTCTGGTCGAATAGTTCTCGAACG
CCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail