Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1373
Gene name
Locationscaffold_1461:594..1547
Strand-
Gene length (bp)953
Transcript length (bp)795
Coding sequence length (bp)792
Protein length (aa) 264

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular|Cell membrane 0.1161 0.0851 0.7679 0.5532 0.0836 0.003 0.2257 0.0659 0.1089 0.0043

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.999721

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup854
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6674
Ophiocordyceps australis map64 (Brazil) OphauB2|4345
Ophiocordyceps camponoti-floridani Ophcf2|00309
Ophiocordyceps camponoti-rufipedis Ophun1|1838
Ophiocordyceps camponoti-rufipedis Ophun1|2514
Ophiocordyceps kimflemingae Ophio5|1373 (this protein)
Ophiocordyceps subramaniannii Hirsu2|4665

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1373
MKSTVALSLLAAATAQATNGYSNEVDVSGPAFLNSAYNAKAGEDFNVKFKGCSSGCTITVKEGQAGNLQNTPISF
DVSGSESTIKIPADAPNGRVALEIKDKNGNINYSPQFEFNGGNSNSNTNNDNNKPVPVPAPAATESAARDSTVQP
AREAPTESAARESTNESAVREATTTAATTTTANTGSNADSDTTTTTATSSEATRDVSSSTLSSGTRNASRTTSSS
TSTRTSTSTSTRIPGDSGVGRNAVPWVMSGAMAALALFN
Coding >Ophio5|1373
ATGAAGTCCACTGTCGCCCTCTCCCTCCTGGCTGCGGCCACGGCCCAGGCCACCAACGGGTACAGCAACGAAGTC
GACGTCAGCGGCCCTGCCTTCCTCAACAGTGCCTACAACGCCAAAGCCGGCGAGGATTTCAACGTCAAGTTCAAG
GGCTGCTCTAGCGGCTGCACCATCACCGTCAAGGAGGGCCAGGCCGGTAACCTCCAGAACACGCCCATTTCCTTC
GACGTCAGCGGCTCGGAATCTACCATCAAGATCCCCGCCGACGCGCCTAACGGCAGAGTCGCGTTGGAGATTAAG
GATAAGAACGGCAATATCAACTACAGCCCGCAGTTTGAATTTAATGGCGGCAACTCCAACTCGAACACCAACAAC
GACAACAACAAGCCCGTCCCCGTCCCGGCCCCGGCCGCTACCGAATCGGCCGCTCGCGACTCGACCGTCCAACCC
GCCCGCGAGGCTCCCACCGAGTCCGCCGCTCGCGAGTCTACCAACGAGTCGGCCGTTCGCGAGGCTACCACGACG
GCCGCTACCACCACCACCGCCAACACTGGTTCCAACGCCGACAGCGACACCACCACCACGACGGCCACGTCCTCC
GAGGCCACCCGGGACGTGTCCTCGTCGACGCTGAGCTCCGGCACCCGCAACGCCTCCCGCACTACCAGCTCCTCT
ACGTCGACCCGCACGTCTACTTCTACGTCGACCCGCATCCCCGGTGACTCGGGCGTTGGCCGCAATGCCGTCCCT
TGGGTCATGTCCGGTGCCATGGCCGCCCTCGCCCTCTTCAAC
Transcript >Ophio5|1373
ATGAAGTCCACTGTCGCCCTCTCCCTCCTGGCTGCGGCCACGGCCCAGGCCACCAACGGGTACAGCAACGAAGTC
GACGTCAGCGGCCCTGCCTTCCTCAACAGTGCCTACAACGCCAAAGCCGGCGAGGATTTCAACGTCAAGTTCAAG
GGCTGCTCTAGCGGCTGCACCATCACCGTCAAGGAGGGCCAGGCCGGTAACCTCCAGAACACGCCCATTTCCTTC
GACGTCAGCGGCTCGGAATCTACCATCAAGATCCCCGCCGACGCGCCTAACGGCAGAGTCGCGTTGGAGATTAAG
GATAAGAACGGCAATATCAACTACAGCCCGCAGTTTGAATTTAATGGCGGCAACTCCAACTCGAACACCAACAAC
GACAACAACAAGCCCGTCCCCGTCCCGGCCCCGGCCGCTACCGAATCGGCCGCTCGCGACTCGACCGTCCAACCC
GCCCGCGAGGCTCCCACCGAGTCCGCCGCTCGCGAGTCTACCAACGAGTCGGCCGTTCGCGAGGCTACCACGACG
GCCGCTACCACCACCACCGCCAACACTGGTTCCAACGCCGACAGCGACACCACCACCACGACGGCCACGTCCTCC
GAGGCCACCCGGGACGTGTCCTCGTCGACGCTGAGCTCCGGCACCCGCAACGCCTCCCGCACTACCAGCTCCTCT
ACGTCGACCCGCACGTCTACTTCTACGTCGACCCGCATCCCCGGTGACTCGGGCGTTGGCCGCAATGCCGTCCCT
TGGGTCATGTCCGGTGCCATGGCCGCCCTCGCCCTCTTCAACTAG
Gene >Ophio5|1373
ATGAAGTCCACTGTCGCCCTCTCCCTCCTGGCTGCGGCCACGGCCCAGGCCACCAACGGGTACAGCAACGAAGTC
GACGTCAGCGGCCCTGCCTTCCTCAACAGTGCCTACAACGCCAAAGCCGGCGAGGATTTCAACGTCAAGTTCAAG
GGCTGCTCTAGCGGCTGCACCATCACCGTCAAGGAGGGCCAGGCCGGTAACCTCCAGAACACGCCCATTTCCTGT
CAGTCTGCTTTCCCAATTTTTCCTCGTCGTCTCATCTACTGATGTAGGAAGGGGGCCAGTCGACGTCAGCGGCTC
GGAATCTACCATCAAGATCCCCGCCGACGCGCCTAACGGCAGAGTCGCGTTGGAGATTAAGGATAAGAACGGCAA
TATCAACTACAGCCCGCAGTTTGAATTTAATGGCGGCAACTCCAACTCGAACACCAACAACGACAACAACAAGCC
CGTCCCCGTCCCGGCCCCGGCCGCTACCGAATCGGCCGCTCGCGACTCGACCGTCCAACCCGCCCGCGAGGCTCC
CACCGAGTCCGCCGCTCGCGAGTCTACCAACGAGTCGGCCGTTCGCGAGGCTACCACGACGGCCGCTACCACCAC
CACCGCCAACACTGGTTCCAACGCCGACAGCGACACCACCACCACGACGGCCACGTCCTCCGAGGCCACCCGGGA
CGTGTCCTCGTCGACGCTGAGCTCCGGCACCCGCAACGCCTCCCGCACTACCAGCTCCTGTATGTTCTTTTTTTT
TTCGGGTGTTTTGCTTCATCTTTCTTCGAAGCTTTGAAGCTAACCAGGGCGCTTTTTTTTCTTTTTCTTTCTTCG
TCCCAGCTACGTCGACCCGCACGTCTACTTCTACGTCGACCCGCATCCCCGGTGACTCGGGCGTTGGCCGCAATG
CCGTCCCTTGGGTCATGTCCGGTGCCATGGCCGCCCTCGCCCTCTTCAACTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail