Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1361
Gene name
Locationscaffold_1458:694..1462
Strand-
Gene length (bp)768
Transcript length (bp)768
Coding sequence length (bp)765
Protein length (aa) 255

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 4.94 0.87 9.00
CcL In ants, during behavior modification 35.60 13.97 57.23
CcD In ants, recently dead 32.95 13.43 52.46

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.000286 yes
SC16a CcD 0.000286 yes
CcL CcD 0.833331 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1361
MKSLSVMTTVVVSLLGFGLADKQDSADKQAAADKQYLASADVLAGNRVLADSNSIAAMGASSTSSADEPCGTSLA
TKLHDGAHCALFFLPQGIFHPKDPFHFKKCCPFGRKKKEISSVSSSSSSSSGGGGGSFGGFVGGGSGSGFGGGGG
SGFGGGGGSGFGGGGGSGFGGGGGSGFGGGGGSGFGEGGGSGFGEGGGSGSGGGGGFNGGGGGSNGRGYTFYSNG
YNPGGSNGGGYVYGNRNGNGFSYSFKRFQA
Coding >Ophio5|1361
ATGAAGTCCCTCTCGGTCATGACGACAGTCGTCGTCAGCCTACTAGGCTTCGGCCTGGCAGATAAGCAAGACTCG
GCCGACAAGCAAGCGGCGGCCGACAAGCAATACCTGGCCTCGGCCGATGTCCTCGCCGGCAATCGAGTGTTGGCC
GACAGCAACTCCATCGCGGCCATGGGGGCCAGCAGCACCTCGTCGGCAGACGAACCCTGCGGCACCAGTCTCGCC
ACCAAGCTGCACGATGGAGCGCATTGCGCCCTGTTCTTTCTCCCGCAGGGCATCTTCCATCCCAAGGACCCCTTT
CACTTTAAGAAGTGCTGTCCGTTTGGTAGGAAGAAGAAGGAAATCTCTTCCGTTTCTTCCAGCAGCAGTTCTAGC
AGTGGTGGTGGTGGCGGGAGCTTCGGCGGCTTCGTCGGCGGCGGTTCCGGCTCCGGCTTCGGGGGAGGCGGCGGT
TCCGGCTTCGGAGGAGGTGGCGGTTCCGGCTTCGGAGGCGGTGGCGGTTCCGGCTTCGGAGGCGGTGGCGGTTCC
GGCTTCGGAGGCGGTGGCGGTTCCGGCTTTGGAGAAGGTGGCGGCTCCGGCTTCGGAGAAGGTGGCGGCTCGGGT
TCCGGCGGCGGCGGCGGCTTCAACGGCGGCGGCGGCGGCTCCAACGGTAGAGGCTACACCTTTTACTCCAACGGC
TACAACCCCGGTGGTTCCAACGGCGGCGGCTACGTCTACGGAAACAGGAACGGCAACGGCTTCTCCTACTCCTTC
AAGAGGTTCCAAGCT
Transcript >Ophio5|1361
ATGAAGTCCCTCTCGGTCATGACGACAGTCGTCGTCAGCCTACTAGGCTTCGGCCTGGCAGATAAGCAAGACTCG
GCCGACAAGCAAGCGGCGGCCGACAAGCAATACCTGGCCTCGGCCGATGTCCTCGCCGGCAATCGAGTGTTGGCC
GACAGCAACTCCATCGCGGCCATGGGGGCCAGCAGCACCTCGTCGGCAGACGAACCCTGCGGCACCAGTCTCGCC
ACCAAGCTGCACGATGGAGCGCATTGCGCCCTGTTCTTTCTCCCGCAGGGCATCTTCCATCCCAAGGACCCCTTT
CACTTTAAGAAGTGCTGTCCGTTTGGTAGGAAGAAGAAGGAAATCTCTTCCGTTTCTTCCAGCAGCAGTTCTAGC
AGTGGTGGTGGTGGCGGGAGCTTCGGCGGCTTCGTCGGCGGCGGTTCCGGCTCCGGCTTCGGGGGAGGCGGCGGT
TCCGGCTTCGGAGGAGGTGGCGGTTCCGGCTTCGGAGGCGGTGGCGGTTCCGGCTTCGGAGGCGGTGGCGGTTCC
GGCTTCGGAGGCGGTGGCGGTTCCGGCTTTGGAGAAGGTGGCGGCTCCGGCTTCGGAGAAGGTGGCGGCTCGGGT
TCCGGCGGCGGCGGCGGCTTCAACGGCGGCGGCGGCGGCTCCAACGGTAGAGGCTACACCTTTTACTCCAACGGC
TACAACCCCGGTGGTTCCAACGGCGGCGGCTACGTCTACGGAAACAGGAACGGCAACGGCTTCTCCTACTCCTTC
AAGAGGTTCCAAGCTTGA
Gene >Ophio5|1361
ATGAAGTCCCTCTCGGTCATGACGACAGTCGTCGTCAGCCTACTAGGCTTCGGCCTGGCAGATAAGCAAGACTCG
GCCGACAAGCAAGCGGCGGCCGACAAGCAATACCTGGCCTCGGCCGATGTCCTCGCCGGCAATCGAGTGTTGGCC
GACAGCAACTCCATCGCGGCCATGGGGGCCAGCAGCACCTCGTCGGCAGACGAACCCTGCGGCACCAGTCTCGCC
ACCAAGCTGCACGATGGAGCGCATTGCGCCCTGTTCTTTCTCCCGCAGGGCATCTTCCATCCCAAGGACCCCTTT
CACTTTAAGAAGTGCTGTCCGTTTGGTAGGAAGAAGAAGGAAATCTCTTCCGTTTCTTCCAGCAGCAGTTCTAGC
AGTGGTGGTGGTGGCGGGAGCTTCGGCGGCTTCGTCGGCGGCGGTTCCGGCTCCGGCTTCGGGGGAGGCGGCGGT
TCCGGCTTCGGAGGAGGTGGCGGTTCCGGCTTCGGAGGCGGTGGCGGTTCCGGCTTCGGAGGCGGTGGCGGTTCC
GGCTTCGGAGGCGGTGGCGGTTCCGGCTTTGGAGAAGGTGGCGGCTCCGGCTTCGGAGAAGGTGGCGGCTCGGGT
TCCGGCGGCGGCGGCGGCTTCAACGGCGGCGGCGGCGGCTCCAACGGTAGAGGCTACACCTTTTACTCCAACGGC
TACAACCCCGGTGGTTCCAACGGCGGCGGCTACGTCTACGGAAACAGGAACGGCAACGGCTTCTCCTACTCCTTC
AAGAGGTTCCAAGCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail