Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1359
Gene name
Locationscaffold_145:30020..31344
Strand-
Gene length (bp)1324
Transcript length (bp)1002
Coding sequence length (bp)999
Protein length (aa) 333

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 4.8E-03 208 244
PF01476 LysM LysM domain 2.2E-07 286 313

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 48 333 4.0E-72
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 36 333 2.0E-62
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 5 181 1.0E-28
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 124 254 2.0E-11
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 204 332 2.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 48 333 4.0E-72
sp|D4ALG0|LYSM1_ARTBC LysM domain-containing protein ARB_05157 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_05157 PE=1 SV=1 36 333 2.0E-62
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 5 181 1.0E-28
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 124 254 2.0E-11
sp|D4AZ68|LYSM3_ARTBC LysM domain-containing protein ARB_01488 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_01488 PE=3 SV=1 204 332 2.0E-09
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 120 176 2.0E-08
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 132 256 3.0E-07
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 200 254 4.0E-07
sp|D4AVW3|LYSM5_ARTBC LysM domain-containing protein ARB_00327 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00327 PE=3 SV=2 116 177 2.0E-06
sp|P39046|MUR2_ENTHA Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=EHR_05900 PE=1 SV=1 128 313 3.0E-06
sp|D4B4P8|LYSM2_ARTBC LysM domain-containing protein ARB_03438 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03438 PE=3 SV=1 214 332 4.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1359
MTPRLLLSLLCVVVVGVAAQGTLVRRNGCSFSPAAEDGDDCVSMAEAWGIEKEQFVRFNPGVNCGILLQVGREYC
VEWAAVATPLPSSAAASPAVQGQGESGGAPAQQGASVPELTQPGITPSCVRYHDVQSGEDCYAIKAKYHHVFSLE
QFYAWNPAVGKDCRALWAGYRVCIGLQGTPSLHTQPPNGIETPFPTQPQIADNCNGFYEVKVGEGCAAIAAAKGI
TVDQFRHWNPSVGKTCTGLWAKANACVSVVGHEPSATKPRNGITTPQPTQAGMVDNCKEFYEVQPGDNCWEISRR
HGIDMLKFIEWNHGVGVGCNALMAYAHACVRVL
Coding >Ophio5|1359
ATGACCCCTCGTCTCCTCTTGAGCCTCCTCTGCGTCGTCGTCGTCGGCGTCGCCGCTCAAGGCACGCTTGTCCGT
CGCAACGGCTGCAGCTTCTCGCCCGCGGCTGAAGATGGCGACGACTGCGTGTCCATGGCCGAGGCCTGGGGCATC
GAAAAGGAACAGTTTGTCCGCTTTAACCCTGGCGTCAACTGCGGCATCCTACTTCAAGTCGGTCGCGAGTATTGT
GTCGAGTGGGCAGCGGTGGCGACGCCTCTTCCGTCCTCTGCCGCTGCTTCGCCTGCTGTTCAGGGACAGGGCGAG
AGCGGTGGAGCCCCGGCCCAGCAAGGCGCTTCGGTTCCCGAGCTGACGCAGCCGGGCATCACTCCCAGCTGCGTG
AGGTACCACGATGTTCAGAGCGGCGAGGATTGCTACGCGATCAAGGCCAAGTATCATCACGTCTTTAGTCTGGAA
CAATTTTACGCTTGGAACCCGGCTGTGGGCAAGGACTGCCGGGCTCTATGGGCTGGATATCGTGTCTGTATTGGC
CTTCAGGGCACGCCGTCTTTACATACTCAGCCTCCGAACGGCATCGAGACGCCTTTTCCCACCCAGCCACAGATT
GCCGACAACTGCAACGGCTTCTACGAGGTCAAGGTCGGAGAAGGCTGTGCCGCCATCGCTGCCGCCAAGGGCATC
ACCGTCGACCAGTTCCGGCACTGGAATCCGTCCGTCGGCAAGACCTGCACTGGGCTCTGGGCCAAGGCCAACGCC
TGCGTCTCCGTCGTCGGACACGAGCCGTCGGCGACGAAGCCCAGGAACGGCATCACGACGCCGCAGCCCACGCAG
GCCGGCATGGTGGACAACTGCAAGGAATTTTACGAGGTTCAGCCCGGCGATAATTGCTGGGAGATTTCTCGTCGT
CACGGAATTGATATGCTCAAGTTCATCGAGTGGAATCATGGCGTGGGGGTCGGTTGCAACGCATTGATGGCTTAT
GCGCACGCCTGTGTTAGGGTCTTG
Transcript >Ophio5|1359
ATGACCCCTCGTCTCCTCTTGAGCCTCCTCTGCGTCGTCGTCGTCGGCGTCGCCGCTCAAGGCACGCTTGTCCGT
CGCAACGGCTGCAGCTTCTCGCCCGCGGCTGAAGATGGCGACGACTGCGTGTCCATGGCCGAGGCCTGGGGCATC
GAAAAGGAACAGTTTGTCCGCTTTAACCCTGGCGTCAACTGCGGCATCCTACTTCAAGTCGGTCGCGAGTATTGT
GTCGAGTGGGCAGCGGTGGCGACGCCTCTTCCGTCCTCTGCCGCTGCTTCGCCTGCTGTTCAGGGACAGGGCGAG
AGCGGTGGAGCCCCGGCCCAGCAAGGCGCTTCGGTTCCCGAGCTGACGCAGCCGGGCATCACTCCCAGCTGCGTG
AGGTACCACGATGTTCAGAGCGGCGAGGATTGCTACGCGATCAAGGCCAAGTATCATCACGTCTTTAGTCTGGAA
CAATTTTACGCTTGGAACCCGGCTGTGGGCAAGGACTGCCGGGCTCTATGGGCTGGATATCGTGTCTGTATTGGC
CTTCAGGGCACGCCGTCTTTACATACTCAGCCTCCGAACGGCATCGAGACGCCTTTTCCCACCCAGCCACAGATT
GCCGACAACTGCAACGGCTTCTACGAGGTCAAGGTCGGAGAAGGCTGTGCCGCCATCGCTGCCGCCAAGGGCATC
ACCGTCGACCAGTTCCGGCACTGGAATCCGTCCGTCGGCAAGACCTGCACTGGGCTCTGGGCCAAGGCCAACGCC
TGCGTCTCCGTCGTCGGACACGAGCCGTCGGCGACGAAGCCCAGGAACGGCATCACGACGCCGCAGCCCACGCAG
GCCGGCATGGTGGACAACTGCAAGGAATTTTACGAGGTTCAGCCCGGCGATAATTGCTGGGAGATTTCTCGTCGT
CACGGAATTGATATGCTCAAGTTCATCGAGTGGAATCATGGCGTGGGGGTCGGTTGCAACGCATTGATGGCTTAT
GCGCACGCCTGTGTTAGGGTCTTGTGA
Gene >Ophio5|1359
ATGACCCCTCGTCTCCTCTTGAGCCTCCTCTGCGTCGTCGTCGTCGGCGTCGCCGCTCAAGGCACGCTTGTCCGT
CGCAACGGCTGCAGCTTCTCGCCCGCGGCTGAAGATGGCGACGACTGCGTGTCCATGGCCGAGGCCTGGGGCATC
GAAAAGGAACAGTTTGTCCGCTTTAACCCTGGCGTCAACTGCGGCATCCTACTTCAAGTCGGTCGCGAGTATTGT
GTCGAGTGGGCAGCGGTGGCGACGCCTCTTCCGTCCTCTGCCGCTGCTTCGCCTGCTGTTCAGGGACAGGGCGAG
AGCGGTGGAGGTAACGATGGTGCATCATCGTTATCGTCATCCTTTTCTAATGCGCAGGCTCCAGCCCCGGCCCAG
CAAGGCGCTTCGGTTCCCGAGCTGACGCAGCCGGGCATCACTCCCAGCTGTAAGCCGGCCCCAAAAAAAATACAC
ACCCTCAAAGTCAGTCTTCTTGGTTGATGATGGGTTCTAAAAGTTTCCCGTTGCAGGCGTGAGGTACCACGATGT
TCAGAGCGGCGAGGATTGCTACGCGATCAAGGCCAAGTATCATCACGTCTTTAGTCTGGAACAATTGTATGATGA
CGCATCTCCGTGTCGACAAGTTTTGCTTCATCATTGCTGACCGAATTAGTTACGCTTGGAACCCGGCTGTGGGCA
AGGGTAAGCATGGGCAGCTCTCCCACACGAGAGCCTCAACTGATTAGTATCAATCACATCTAGACTGCCGGGCTC
TATGGGCTGGATATCGTGTCTGTATTGGCCTTCAGGGCACGCCGTCTTTACATACTCAGCCTCCGAACGGCAAGT
CCTCGTATATTTATTCAAGCTGGCATCGAGTAAGCTGATCTTTTGCCACTCTTCTCTAATAGGCATCGAGACGCC
TTTTCCCACCCAGCCACAGATTGCCGACAACTGCAACGGCTTCTACGAGGTCAAGGTCGGAGAAGGCTGTGCCGC
CATCGCTGCCGCCAAGGGCATCACCGTCGACCAGTTCCGGCACTGGAATCCGTCCGTCGGCAAGACCTGCACTGG
GCTCTGGGCCAAGGCCAACGCCTGCGTCTCCGTCGTCGGACACGAGCCGTCGGCGACGAAGCCCAGGAACGGCAT
CACGACGCCGCAGCCCACGCAGGCCGGCATGGTGGACAACTGCAAGGAATTTTACGAGGTTCAGCCCGGCGATAA
TTGCTGGGAGATTTCTCGTCGTCACGGAATTGATATGCTCAAGTTCATCGAGTGGAATCATGGCGTGGGGGTCGG
TTGCAACGCATTGATGGCTTATGCGCACGCCTGTGTTAGGGTCTTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail