Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|135
Gene name
Locationscaffold_1009:1181..1656
Strand+
Gene length (bp)475
Transcript length (bp)408
Coding sequence length (bp)405
Protein length (aa) 135

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00545 Ribonuclease ribonuclease 3.9E-06 49 128

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|D4AVI0|RNF1_ARTBC Extracellular guanyl-specific ribonuclease ARB_00194 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00194 PE=1 SV=1 33 135 9.0E-40
sp|P10282|RNF1_GIBFU Guanyl-specific ribonuclease F1 OS=Gibberella fujikuroi PE=1 SV=4 11 135 2.0E-37
sp|P26875|RNT1_TRIHA Guanyl-specific ribonuclease Th1 OS=Trichoderma harzianum PE=1 SV=1 33 134 2.0E-36
sp|P16411|RNF1_GIBBA Extracellular guanyl-specific ribonuclease Fl1 OS=Gibberella baccata PE=1 SV=1 33 134 1.0E-33
sp|P16412|RNF2_GIBBA Extracellular guanyl-specific ribonuclease Fl2 OS=Gibberella baccata PE=1 SV=2 33 134 4.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|D4AVI0|RNF1_ARTBC Extracellular guanyl-specific ribonuclease ARB_00194 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_00194 PE=1 SV=1 33 135 9.0E-40
sp|P10282|RNF1_GIBFU Guanyl-specific ribonuclease F1 OS=Gibberella fujikuroi PE=1 SV=4 11 135 2.0E-37
sp|P26875|RNT1_TRIHA Guanyl-specific ribonuclease Th1 OS=Trichoderma harzianum PE=1 SV=1 33 134 2.0E-36
sp|P16411|RNF1_GIBBA Extracellular guanyl-specific ribonuclease Fl1 OS=Gibberella baccata PE=1 SV=1 33 134 1.0E-33
sp|P16412|RNF2_GIBBA Extracellular guanyl-specific ribonuclease Fl2 OS=Gibberella baccata PE=1 SV=2 33 134 4.0E-32
sp|P00651|RNT1_ASPOR Guanyl-specific ribonuclease T1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rntA PE=1 SV=2 33 132 2.0E-28
sp|P00652|RNC2_ASPCL Guanyl-specific ribonuclease C2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_055300 PE=1 SV=2 26 133 1.0E-25
sp|P09646|RNN1_NEUCR Guanyl-specific ribonuclease N1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=grn PE=1 SV=2 33 132 1.0E-25
sp|Q7M515|RNA1_ASPPL Guanyl-specific ribonuclease Ap1 OS=Aspergillus pallidus PE=1 SV=1 28 131 5.0E-24
sp|P09647|RNPC_PENCH Guanyl-specific ribonuclease Pc OS=Penicillium chrysogenum PE=1 SV=1 33 131 1.0E-20
sp|P07446|RNPB_PENBR Guanyl-specific ribonuclease Pb1 OS=Penicillium brevicompactum PE=1 SV=1 32 132 4.0E-20
sp|P00653|RNMS_ASPPH Guanyl-specific ribonuclease Ms OS=Aspergillus phoenicis PE=1 SV=2 30 134 4.0E-20
sp|P07736|RNU1_USTSP Guanyl-specific ribonuclease U1 OS=Ustilago sphaerogena PE=1 SV=2 27 132 2.0E-19
sp|P81762|RNPO_PLEOS Guanyl-specific ribonuclease Po1 OS=Pleurotus ostreatus PE=1 SV=1 52 131 3.0E-11
sp|P00654|RNU2_USTSP Ribonuclease U2 OS=Ustilago sphaerogena GN=RNU2 PE=1 SV=4 32 132 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0004521 endoribonuclease activity Yes
GO:0003723 RNA binding Yes
GO:0016787 hydrolase activity No
GO:0003676 nucleic acid binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:0005488 binding No
GO:0004518 nuclease activity No
GO:0140098 catalytic activity, acting on RNA No
GO:0004540 ribonuclease activity No
GO:0003824 catalytic activity No
GO:0004519 endonuclease activity No
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0016788 hydrolase activity, acting on ester bonds No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 24 0.45

Transmembrane Domains

Domain # Start End Length
1 4 26 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|135
MHHLPLPLPLVLLFGLFTGLARAAAIGDVQIQCGRTFYSARDVEAASAAACNYVKEEDTAGESTYPHQYNNFEAF
RFHDYEGPFYEFPILSSGRVYSGGRPGPDRVVITERCEEAGQITHSGAGGNSFIGCSGTD
Coding >Ophio5|135
ATGCATCATCTCCCCCTCCCCCTCCCCCTCGTCCTCCTCTTCGGTCTTTTCACCGGCCTGGCACGTGCTGCGGCG
ATAGGTGACGTCCAAATTCAATGCGGCCGAACCTTTTACTCGGCCCGGGACGTGGAAGCGGCATCGGCAGCGGCG
TGCAACTACGTCAAGGAGGAAGACACAGCCGGAGAATCGACGTACCCGCACCAGTATAACAACTTTGAGGCTTTT
CGCTTCCACGACTATGAGGGCCCCTTTTACGAGTTTCCCATCCTGTCGTCGGGTCGTGTCTATAGCGGCGGTCGT
CCGGGTCCGGACCGGGTTGTCATTACCGAGCGGTGTGAGGAGGCTGGGCAAATCACTCACTCTGGCGCGGGCGGG
AACAGCTTTATCGGCTGCTCCGGCACCGAT
Transcript >Ophio5|135
ATGCATCATCTCCCCCTCCCCCTCCCCCTCGTCCTCCTCTTCGGTCTTTTCACCGGCCTGGCACGTGCTGCGGCG
ATAGGTGACGTCCAAATTCAATGCGGCCGAACCTTTTACTCGGCCCGGGACGTGGAAGCGGCATCGGCAGCGGCG
TGCAACTACGTCAAGGAGGAAGACACAGCCGGAGAATCGACGTACCCGCACCAGTATAACAACTTTGAGGCTTTT
CGCTTCCACGACTATGAGGGCCCCTTTTACGAGTTTCCCATCCTGTCGTCGGGTCGTGTCTATAGCGGCGGTCGT
CCGGGTCCGGACCGGGTTGTCATTACCGAGCGGTGTGAGGAGGCTGGGCAAATCACTCACTCTGGCGCGGGCGGG
AACAGCTTTATCGGCTGCTCCGGCACCGATTGA
Gene >Ophio5|135
ATGCATCATCTCCCCCTCCCCCTCCCCCTCGTCCTCCTCTTCGGTCTTTTCACCGGCCTGGCACGTGCTGCGGCG
ATAGGTGACGTCCAAATTCAATGCGGCCGAACCTTTTACTCGGCCCGGGACGTGGAAGCGGCATCGGCAGCGGCG
TGCAACTACGTCAAGGAGGAAGACACAGCCGGAGAATCGACGTACCCGCACCAGTATAACAACTTTGAGGCTTTT
CGCTTCCACGACTATGAGGGCCCCTTTTACGAGTTTCCCATCCTGTCGTCGGGTCGTGTCTATAGCGGCGGTGCG
TTGATCCGTCCGATTGGGGGCTCTCTCTGACCGAGCCGCTGACTCCGTTGATGCAATTCAAGGTCGTCCGGGTCC
GGACCGGGTTGTCATTACCGAGCGGTGTGAGGAGGCTGGGCAAATCACTCACTCTGGCGCGGGCGGGAACAGCTT
TATCGGCTGCTCCGGCACCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail