Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1349
Gene name
Locationscaffold_145:6500..8531
Strand+
Gene length (bp)2031
Transcript length (bp)1620
Coding sequence length (bp)1617
Protein length (aa) 539

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00264 Tyrosinase Common central domain of tyrosinase 8.5E-40 75 318

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 27 385 3.0E-47
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 27 422 2.0E-45
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 58 404 3.0E-45
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 32 407 3.0E-41
sp|C7FF04|PPO3_AGABI Polyphenol oxidase 3 OS=Agaricus bisporus GN=PPO3 PE=1 SV=1 58 402 3.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92396|TYRO_PODAS Tyrosinase OS=Podospora anserina GN=TYR PE=2 SV=1 27 385 3.0E-47
sp|P00440|TYRO_NEUCR Tyrosinase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=T PE=1 SV=5 27 422 2.0E-45
sp|A7BHQ9|TYRO_PHONA Tyrosinase OS=Pholiota nameko GN=tyr1 PE=1 SV=1 58 404 3.0E-45
sp|Q00024|PPO1_AGABI Polyphenol oxidase 1 OS=Agaricus bisporus GN=PPO1 PE=2 SV=1 32 407 3.0E-41
sp|C7FF04|PPO3_AGABI Polyphenol oxidase 3 OS=Agaricus bisporus GN=PPO3 PE=1 SV=1 58 402 3.0E-35
sp|O42713|PPO2_AGABI Polyphenol oxidase 2 OS=Agaricus bisporus GN=PPO2 PE=2 SV=1 58 378 1.0E-34
sp|Q8J130|TYRO_ASPFU Tyrosinase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tyr1 PE=3 SV=2 27 405 1.0E-29
sp|C7FF05|PPO4_AGABI Polyphenol oxidase 4 OS=Agaricus bisporus GN=PPO4 PE=2 SV=1 58 378 2.0E-29
sp|O61363|HCYG_ENTDO Hemocyanin G-type, units Oda to Odg OS=Enteroctopus dofleini GN=ODHCY PE=1 SV=1 42 418 6.0E-11
sp|P12659|HCYA_ENTDO Hemocyanin A-type, units Ode to Odg (Fragment) OS=Enteroctopus dofleini PE=2 SV=2 106 404 3.0E-10
sp|O61363|HCYG_ENTDO Hemocyanin G-type, units Oda to Odg OS=Enteroctopus dofleini GN=ODHCY PE=1 SV=1 106 404 1.0E-09
sp|P81732|HC2C_MEGCR Hemocyanin 2-c chain OS=Megathura crenulata PE=1 SV=1 271 439 1.0E-08
sp|O61363|HCYG_ENTDO Hemocyanin G-type, units Oda to Odg OS=Enteroctopus dofleini GN=ODHCY PE=1 SV=1 106 400 1.0E-07
sp|P12659|HCYA_ENTDO Hemocyanin A-type, units Ode to Odg (Fragment) OS=Enteroctopus dofleini PE=2 SV=2 271 400 1.0E-07
sp|P80960|HCY2A_RAPVE Hemocyanin type 2 unit a OS=Rapana venosa PE=1 SV=2 271 381 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 4.51 1.29 7.73
CcL In ants, during behavior modification 8.56 3.15 13.97
CcD In ants, recently dead 11.02 4.47 17.56

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.058681 no
SC16a CcD 0.007944 yes
CcL CcD 0.442330 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1349
MLHREAVAFLSLGLALLVLARPDHQPVTGAPVSPHFEGAPLRRDINELSAAGGPQWHLYLLALRAMQLDSDDNPL
SYFQLMGIHGAPYIEWNGAGAQVDGDWQGYCPHTEDIFLPWHRPHAALFEQVLVSKAKQIALTYPESVRAEYTRA
AETLRSPYWDWARDSRVPPATVPSKVRVNHSSGAFGNSQVGEIELDNPLRTYRFPKAVLDGKYGKFDPFRRPETY
RCRTAAGFPADANRRLGRFPIGQFVYDVFTGARSFVEFCRGNGGVISLEQIHDSIHFDAACREHLIEVELAAFDP
IFMLHHTQVDRLWAYWQALHPDDGDDVFQEPYIGKARFSTAKSTLITIDSPLTPFFHPSKAFHTTRSVRDIRDFG
YSYQGLEWWRRDKNQMRREAARVINSYGAPKRPRTRHFARLRVHVADFGRPCMVNVFIKDRIVTRITNEVWPNPG
SVWTGFGLDEFGVDQHDLTNMTIGLQVSKYDGSDVPMEAISQISAEIEVIEVAPPLSVEELQPSRPSRILPASVT
LIRGQNGTTFADSL
Coding >Ophio5|1349
ATGCTGCATCGGGAAGCGGTGGCGTTTCTTAGCCTGGGCCTGGCCCTTCTTGTCCTCGCCCGGCCAGACCATCAG
CCAGTCACGGGCGCCCCCGTAAGTCCACACTTCGAGGGGGCTCCTCTCAGGAGGGACATCAACGAACTGTCAGCG
GCCGGAGGCCCTCAATGGCACCTGTATCTGCTCGCGCTCCGTGCTATGCAGTTGGACAGCGACGACAACCCCTTG
TCCTACTTTCAGCTGATGGGTATCCACGGCGCACCGTATATCGAATGGAACGGTGCCGGAGCCCAGGTTGACGGT
GACTGGCAAGGTTACTGTCCTCACACCGAAGACATCTTTCTACCATGGCACCGGCCTCACGCTGCACTCTTCGAG
CAAGTTCTCGTCAGCAAGGCCAAGCAGATCGCCCTGACGTATCCCGAGAGCGTCAGGGCCGAGTACACACGCGCG
GCCGAAACGCTCCGCTCCCCCTACTGGGACTGGGCCCGCGACTCGCGTGTGCCGCCTGCCACCGTCCCCTCCAAG
GTCCGCGTCAACCACAGCAGCGGCGCTTTTGGCAACAGCCAGGTGGGCGAGATCGAGCTGGACAACCCCCTGCGC
ACTTACCGCTTCCCCAAGGCCGTCCTGGACGGCAAGTATGGCAAGTTTGATCCGTTCCGTAGGCCCGAGACCTAT
CGTTGCCGGACAGCCGCTGGATTCCCGGCCGACGCCAACCGGCGGCTGGGCAGGTTCCCGATCGGCCAATTCGTG
TACGACGTCTTCACCGGTGCTCGCAGCTTCGTCGAGTTCTGTCGCGGAAACGGCGGCGTCATCAGCCTGGAGCAG
ATACATGACTCCATCCACTTCGACGCCGCATGCCGCGAGCACCTCATCGAGGTCGAGCTGGCAGCCTTTGATCCC
ATCTTTATGTTGCATCACACCCAGGTGGATCGCCTGTGGGCGTACTGGCAGGCCCTCCACCCAGACGACGGCGAC
GACGTCTTCCAGGAGCCCTACATCGGCAAGGCGCGCTTCTCGACGGCCAAGTCGACTCTCATCACCATCGACTCG
CCCTTGACGCCCTTCTTCCACCCGTCCAAGGCCTTCCACACCACTCGTTCGGTCCGTGACATCCGCGACTTTGGC
TACTCGTATCAAGGCCTCGAGTGGTGGCGCCGTGACAAGAATCAGATGCGACGTGAGGCCGCACGCGTCATCAAC
AGCTACGGCGCCCCCAAGCGACCTAGGACCCGGCACTTTGCCCGTCTGCGCGTCCATGTTGCTGATTTCGGTCGC
CCCTGCATGGTCAACGTCTTTATAAAGGACCGCATAGTGACGCGCATCACGAACGAGGTGTGGCCCAACCCCGGC
AGCGTCTGGACCGGCTTCGGACTGGACGAGTTTGGTGTCGATCAGCATGATCTGACCAACATGACCATCGGCCTC
CAGGTCTCCAAATACGACGGCAGTGACGTTCCCATGGAGGCCATCAGCCAGATAAGCGCCGAGATCGAGGTCATC
GAGGTTGCGCCGCCCCTGTCCGTTGAAGAGCTCCAGCCGTCACGGCCGTCGCGTATATTGCCGGCCTCGGTGACG
TTGATCCGCGGCCAGAATGGCACAACCTTTGCGGATTCGTTG
Transcript >Ophio5|1349
ATGCTGCATCGGGAAGCGGTGGCGTTTCTTAGCCTGGGCCTGGCCCTTCTTGTCCTCGCCCGGCCAGACCATCAG
CCAGTCACGGGCGCCCCCGTAAGTCCACACTTCGAGGGGGCTCCTCTCAGGAGGGACATCAACGAACTGTCAGCG
GCCGGAGGCCCTCAATGGCACCTGTATCTGCTCGCGCTCCGTGCTATGCAGTTGGACAGCGACGACAACCCCTTG
TCCTACTTTCAGCTGATGGGTATCCACGGCGCACCGTATATCGAATGGAACGGTGCCGGAGCCCAGGTTGACGGT
GACTGGCAAGGTTACTGTCCTCACACCGAAGACATCTTTCTACCATGGCACCGGCCTCACGCTGCACTCTTCGAG
CAAGTTCTCGTCAGCAAGGCCAAGCAGATCGCCCTGACGTATCCCGAGAGCGTCAGGGCCGAGTACACACGCGCG
GCCGAAACGCTCCGCTCCCCCTACTGGGACTGGGCCCGCGACTCGCGTGTGCCGCCTGCCACCGTCCCCTCCAAG
GTCCGCGTCAACCACAGCAGCGGCGCTTTTGGCAACAGCCAGGTGGGCGAGATCGAGCTGGACAACCCCCTGCGC
ACTTACCGCTTCCCCAAGGCCGTCCTGGACGGCAAGTATGGCAAGTTTGATCCGTTCCGTAGGCCCGAGACCTAT
CGTTGCCGGACAGCCGCTGGATTCCCGGCCGACGCCAACCGGCGGCTGGGCAGGTTCCCGATCGGCCAATTCGTG
TACGACGTCTTCACCGGTGCTCGCAGCTTCGTCGAGTTCTGTCGCGGAAACGGCGGCGTCATCAGCCTGGAGCAG
ATACATGACTCCATCCACTTCGACGCCGCATGCCGCGAGCACCTCATCGAGGTCGAGCTGGCAGCCTTTGATCCC
ATCTTTATGTTGCATCACACCCAGGTGGATCGCCTGTGGGCGTACTGGCAGGCCCTCCACCCAGACGACGGCGAC
GACGTCTTCCAGGAGCCCTACATCGGCAAGGCGCGCTTCTCGACGGCCAAGTCGACTCTCATCACCATCGACTCG
CCCTTGACGCCCTTCTTCCACCCGTCCAAGGCCTTCCACACCACTCGTTCGGTCCGTGACATCCGCGACTTTGGC
TACTCGTATCAAGGCCTCGAGTGGTGGCGCCGTGACAAGAATCAGATGCGACGTGAGGCCGCACGCGTCATCAAC
AGCTACGGCGCCCCCAAGCGACCTAGGACCCGGCACTTTGCCCGTCTGCGCGTCCATGTTGCTGATTTCGGTCGC
CCCTGCATGGTCAACGTCTTTATAAAGGACCGCATAGTGACGCGCATCACGAACGAGGTGTGGCCCAACCCCGGC
AGCGTCTGGACCGGCTTCGGACTGGACGAGTTTGGTGTCGATCAGCATGATCTGACCAACATGACCATCGGCCTC
CAGGTCTCCAAATACGACGGCAGTGACGTTCCCATGGAGGCCATCAGCCAGATAAGCGCCGAGATCGAGGTCATC
GAGGTTGCGCCGCCCCTGTCCGTTGAAGAGCTCCAGCCGTCACGGCCGTCGCGTATATTGCCGGCCTCGGTGACG
TTGATCCGCGGCCAGAATGGCACAACCTTTGCGGATTCGTTGTAA
Gene >Ophio5|1349
ATGCTGCATCGGGAAGCGGTGGCGTTTCTTAGCCTGGGCCTGGCCCTTCTTGTCCTCGCCCGGCCAGACCATCAG
CCAGTCACGGGCGCCCCCGTAAGTCCACACTTCGAGGGGGCTCCTCTCAGGAGGGACATCAACGAACTGTCAGCG
GCCGGAGGCCCTCAATGGTGAGCAAAGTCCGTTCGGTTGTTACCTTTTTGCTTATGCTGACATGGCAGGCACCTG
TATCTGCTCGCGCTCCGTGCTATGCAGTTGGACAGCGACGACAACCCCTTGTCCTACTTTCAGCTGATGGGTAAG
AGCAGGCCCCCCTTCGAGCAAAAGTTCTCGACGTATATAACACATAAGCTGATGCCGCGTTAGGTATCCACGGCG
CACCGTATATCGAATGGAACGGTGCCGGAGCCCAGGTTGACGGTGACTGGCAAGGTTACTGTCCTCACACCGTAA
GGCCACGTCTCTGCCGCGACGTGTACGCTTGCGAGCTGACGGCGGCGACGACGACGACGTAGGAAGACATCTTTC
TACCATGGCACCGGCCTCACGCTGCACTCTTCGAGGTATGTCGTCACAACGAGACCCCGGGAGGTCATCCACTGA
CACGTCTCTTGCAGCAAGTTCTCGTCAGCAAGGCCAAGCAGATCGCCCTGACGTATCCCGAGAGCGTCAGGGCCG
AGTACACACGCGCGGCCGAAACGCTCCGCTCCCCCTACTGGGACTGGGCCCGCGACTCGCGTGTGCCGCCTGCCA
CCGTCCCCTCCAAGGTCCGCGTCAACCACAGCAGCGGCGCTTTTGGCAACAGCCAGGTGGGCGAGATCGAGCTGG
ACAACCCCCTGCGCACTTACCGCTTCCCCAAGGCCGTCCTGGACGGCAAGTATGGCAAGTTTGATCCGTTCCGTA
GGCCCGAGACCTATCGTTGCCGGACAGCCGCTGGATTCCCGGCCGACGCCAACCGGCGGCTGGGCAGGTTCCCGA
TCGGCCAATTCGTGGTGAGTGTCCATATCATCAAGGGAAAAGAACCGAGGACGGGCCGCTGAGAGAAAGTATTGT
CGATAGTACGACGTCTTCACCGGTGCTCGCAGCTTCGTCGAGTTCTGTCGCGGAAACGGCGGCGTCATCAGCCTG
GAGCAGATACATGACTCCATCCACTTCGACGCCGCATGCCGCGAGCACCTCATCGAGGTCGAGCTGGCAGCCTTT
GATCCCATCTTGTGCGTCGTCATCCAGTTCGGGCTCCAAAGCGACGGAAGCTGACAGGCGTCCCAGTATGTTGCA
TCACACCCAGGTGGATCGCCTGTGGGCGTACTGGCAGGCCCTCCACCCAGACGACGGCGACGACGTCTTCCAGGA
GCCCTACATCGGCAAGGCGCGCTTCTCGACGGCCAAGTCGACTCTCATCACCATCGACTCGCCCTTGACGCCCTT
CTTCCACCCGTCCAAGGCCTTCCACACCACTCGTTCGGTCCGTGACATCCGCGACTTTGGCTACTCGTATCAAGG
CCTCGAGTGGTGGCGCCGTGACAAGAATCAGATGCGACGTGAGGCCGCACGCGTCATCAACAGCTACGGCGCCCC
CAAGCGACCTAGGACCCGGCACTTTGCCCGTCTGCGCGTCCATGTTGCTGATTTCGGTCGCCCCTGCATGGTCAA
CGTCTTTATAAAGGACCGCATAGTGACGCGCATCACGAACGAGGTGTGGCCCAACCCCGGCAGCGTCTGGACCGG
CTTCGGACTGGACGAGTTTGGTGTCGATCAGCATGATCTGACCAACATGACCATCGGCCTCCAGGTCTCCAAAGT
TTGTTCCCCCCTCCTTTGTGCCCCCCCTGGCTAACGACCCCTGTGCAGTACGACGGCAGTGACGTTCCCATGGAG
GCCATCAGCCAGATAAGCGCCGAGATCGAGGTCATCGAGGTTGCGCCGCCCCTGTCCGTTGAAGAGCTCCAGCCG
TCACGGCCGTCGCGTATATTGCCGGCCTCGGTGACGTTGATCCGCGGCCAGAATGGCACAACCTTTGCGGATTCG
TTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail