Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1348
Gene name
Locationscaffold_145:4283..4909
Strand-
Gene length (bp)626
Transcript length (bp)585
Coding sequence length (bp)582
Protein length (aa) 194

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 7.2E-16 62 167

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 58 185 5.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 53 181 2.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 44 181 6.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 58 183 9.0E-10
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 61 141 1.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 58 185 5.0E-12
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 53 181 2.0E-10
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 44 181 6.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 58 183 9.0E-10
sp|P94459|PPSD_BACSU Plipastatin synthase subunit D OS=Bacillus subtilis (strain 168) GN=ppsD PE=1 SV=2 61 141 1.0E-09
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 58 182 5.0E-09
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 58 189 1.0E-08
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 60 173 1.0E-08
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 66 186 1.0E-08
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 20 141 3.0E-08
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 58 185 3.0E-08
sp|Q0VZ70|CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus GN=cmdD PE=1 SV=1 57 182 4.0E-08
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 66 186 5.0E-08
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 74 186 6.0E-08
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 21 163 8.0E-08
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 53 169 8.0E-08
sp|Q70LM7|LGRA_BREPA Linear gramicidin synthase subunit A OS=Brevibacillus parabrevis GN=lgrA PE=1 SV=1 60 141 1.0E-07
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 29 153 1.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 60 186 1.0E-07
sp|O31827|PPSE_BACSU Plipastatin synthase subunit E OS=Bacillus subtilis (strain 168) GN=ppsE PE=1 SV=1 61 182 2.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 55 190 2.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 58 164 3.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 24 181 3.0E-07
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 58 163 4.0E-07
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 58 163 4.0E-07
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 58 170 5.0E-07
sp|Q9R9I9|MYCC_BACIU Mycosubtilin synthase subunit C OS=Bacillus subtilis GN=mycC PE=3 SV=1 60 149 6.0E-07
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 60 141 7.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 54 182 7.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 60 165 7.0E-07
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 60 186 7.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 60 141 7.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 62 141 8.0E-07
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 58 179 9.0E-07
sp|O68006|BACA_BACLI Bacitracin synthase 1 OS=Bacillus licheniformis GN=bacA PE=3 SV=1 56 148 9.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 66 181 1.0E-06
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 45 169 1.0E-06
sp|P27206|SRFAA_BACSU Surfactin synthase subunit 1 OS=Bacillus subtilis (strain 168) GN=srfAA PE=1 SV=4 60 164 1.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 56 181 1.0E-06
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 58 189 2.0E-06
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 60 140 2.0E-06
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 60 140 2.0E-06
sp|P39845|PPSA_BACSU Plipastatin synthase subunit A OS=Bacillus subtilis (strain 168) GN=ppsA PE=1 SV=2 4 165 3.0E-06
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 58 189 3.0E-06
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 58 179 3.0E-06
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 60 164 4.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 58 152 4.0E-06
sp|Q70LM6|LGRB_BREPA Linear gramicidin synthase subunit B OS=Brevibacillus parabrevis GN=lgrB PE=1 SV=1 47 182 6.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 60 182 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.6217 0.4869 0.3004 0.0823 0.3609 0.3225 0.132 0.2079 0.2666 0.0188

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 2.09 0.0 4.45
CcL In ants, during behavior modification 1.81 0.0 3.88
CcD In ants, recently dead 1.34 0.0 3.13

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.846886 no
SC16a CcD 0.531350 no
CcL CcD 0.701469 no

Orthologs

Orthofinder run ID4
Orthogroup216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4864
Ophiocordyceps australis map64 (Brazil) OphauB2|263
Ophiocordyceps australis map64 (Brazil) OphauB2|352
Ophiocordyceps camponoti-floridani Ophcf2|03985
Ophiocordyceps camponoti-rufipedis Ophun1|1885
Ophiocordyceps kimflemingae Ophio5|1347
Ophiocordyceps kimflemingae Ophio5|1348 (this protein)
Ophiocordyceps kimflemingae Ophio5|7675
Ophiocordyceps subramaniannii Hirsu2|2141
Ophiocordyceps subramaniannii Hirsu2|4799
Ophiocordyceps subramaniannii Hirsu2|7001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1348
MAMALSAGQLALAPFATTPDDHLSLPESAQKRCMKMNKAREETEEATYRQVAEAGLGLAQLFYKQAQKNAEAMAV
VDGSTSLSYGQLHARAARLAHLLNLGGDAAGLGQEPVGIVVQHGVADVVAQMAVLYAGGSCAPMDPTLVDHQIEA
RLTRLDARFVVVDEENMGRALPFEILCIDRDADSAAGTDSGYYA
Coding >Ophio5|1348
ATGGCCATGGCCCTTTCCGCTGGGCAGCTCGCCCTCGCGCCCTTTGCCACCACCCCTGACGACCACCTCTCCCTG
CCCGAGTCGGCCCAAAAACGATGCATGAAGATGAACAAGGCGAGAGAAGAAACAGAAGAAGCCACGTACAGACAG
GTGGCGGAGGCTGGCCTTGGCCTCGCCCAGCTCTTCTACAAGCAGGCACAGAAGAATGCCGAAGCCATGGCCGTC
GTCGACGGATCGACGTCGCTTTCGTACGGCCAGCTGCATGCTCGAGCCGCTCGTCTGGCCCACCTTCTTAATCTG
GGCGGCGACGCGGCCGGACTGGGACAAGAGCCCGTCGGTATCGTGGTGCAGCATGGCGTGGCTGATGTCGTGGCC
CAGATGGCTGTGCTCTATGCCGGCGGCAGCTGTGCGCCCATGGACCCTACCCTGGTCGATCATCAGATTGAGGCG
AGGCTGACGAGGCTGGACGCGAGGTTTGTTGTTGTGGATGAGGAGAACATGGGACGGGCGTTGCCGTTTGAAATT
CTCTGTATTGATCGGGATGCTGATTCGGCCGCTGGGACCGACTCCGGCTACTACGCC
Transcript >Ophio5|1348
ATGGCCATGGCCCTTTCCGCTGGGCAGCTCGCCCTCGCGCCCTTTGCCACCACCCCTGACGACCACCTCTCCCTG
CCCGAGTCGGCCCAAAAACGATGCATGAAGATGAACAAGGCGAGAGAAGAAACAGAAGAAGCCACGTACAGACAG
GTGGCGGAGGCTGGCCTTGGCCTCGCCCAGCTCTTCTACAAGCAGGCACAGAAGAATGCCGAAGCCATGGCCGTC
GTCGACGGATCGACGTCGCTTTCGTACGGCCAGCTGCATGCTCGAGCCGCTCGTCTGGCCCACCTTCTTAATCTG
GGCGGCGACGCGGCCGGACTGGGACAAGAGCCCGTCGGTATCGTGGTGCAGCATGGCGTGGCTGATGTCGTGGCC
CAGATGGCTGTGCTCTATGCCGGCGGCAGCTGTGCGCCCATGGACCCTACCCTGGTCGATCATCAGATTGAGGCG
AGGCTGACGAGGCTGGACGCGAGGTTTGTTGTTGTGGATGAGGAGAACATGGGACGGGCGTTGCCGTTTGAAATT
CTCTGTATTGATCGGGATGCTGATTCGGCCGCTGGGACCGACTCCGGCTACTACGCCTAA
Gene >Ophio5|1348
ATGGCCATGGCCCTTTCCGCTGGGCAGCTCGCCCTCGCGCCCTTTGCCACCACCCCTGACGACCACCTCTCCCTG
CCCGAGTCGGCCCAAAAACGATGCATGAAGATGAACAAGGCGAGAGAAGAAACAGAAGAAGCCACGTACAGACAG
GTGGCGGAGGCTGGCCTTGGCCTCGCCCAGCTCTTCTACAAGCAGGCACAGAAGAATGCCGAAGCCATGGCCGTC
GTCGACGGATCGACGTCGCTTTCGTACGGCCAGCTGCATGCTCGAGCCGCTCGTCTGGCCCACCTTCTTAATCTG
GGCGGCGACGCGGCCGGACTGGGACAAGAGCCCGTCGGTATCGTGGTGCAGCATGGCGTGGCTGATGTCGTGGCC
CAGATGGCTGTGCTCTATGCCGGCGGCAGCTGTGCGCCCATGGACCCTACCCTGGTCGATCATCAGATTGAGGCG
AGGCTGACGAGGCTGGACGCGAGGTTTGTTGTTGTGGATGAGGAGAACATGGGACGGGCGTTGCCGTTTGAAATT
CTCTGTATTGATCGGGATGCTGGTGAGGAGCTGGTTCCGGCCCCGACTCCGGCTCTGGTCAAGATTCGGCCGCTG
GGACCGACTCCGGCTACTACGCCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail