Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1347
Gene name
Locationscaffold_145:1351..2842
Strand-
Gene length (bp)1491
Transcript length (bp)1491
Coding sequence length (bp)1488
Protein length (aa) 496

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.9E-57 114 358
PF00550 PP-binding Phosphopantetheine attachment site 2.1E-08 3 63
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.0E-08 112 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5 410 8.0E-62
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 14 480 2.0E-58
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 23 379 3.0E-46
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 20 367 5.0E-43
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1 369 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5 410 8.0E-62
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 14 480 2.0E-58
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 23 379 3.0E-46
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 20 367 5.0E-43
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1 369 2.0E-41
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4 365 3.0E-40
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 20 412 8.0E-40
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 111 365 2.0E-38
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 102 371 3.0E-23
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 82 371 2.0E-20
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 79 422 4.0E-20
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 20 422 8.0E-18
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 22 410 2.0E-17
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 103 339 1.0E-15
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 112 367 2.0E-14
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 107 339 1.0E-13
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 112 367 3.0E-13
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 112 370 2.0E-12
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 106 339 2.0E-12
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 328 2.0E-12
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 97 355 3.0E-11
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 113 339 1.0E-09
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 105 344 6.0E-09
sp|A1ZAI3|FACR2_DROME Putative fatty acyl-CoA reductase CG8303 OS=Drosophila melanogaster GN=CG8303 PE=2 SV=2 111 359 4.0E-08
sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 112 312 5.0E-08
sp|Q08891|FACR2_ARATH Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana GN=FAR2 PE=2 SV=2 109 232 5.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 92 4.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 94 9.0E-06
[Show less]

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm Peroxisomal targeting signal 0.5912 0.2114 0.2161 0.1604 0.2724 0.1308 0.1304 0.4089 0.3538 0.4056

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup216
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4864
Ophiocordyceps australis map64 (Brazil) OphauB2|263
Ophiocordyceps australis map64 (Brazil) OphauB2|352
Ophiocordyceps camponoti-floridani Ophcf2|03985
Ophiocordyceps camponoti-rufipedis Ophun1|1885
Ophiocordyceps kimflemingae Ophio5|1347 (this protein)
Ophiocordyceps kimflemingae Ophio5|1348
Ophiocordyceps kimflemingae Ophio5|7675
Ophiocordyceps subramaniannii Hirsu2|2141
Ophiocordyceps subramaniannii Hirsu2|4799
Ophiocordyceps subramaniannii Hirsu2|7001

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1347
MAGLWASILAAPVGGYYDDDDDFISLGGSSLQASLLVSQIRQTFGLEVPLLTLYRDFSLGAVSAVVAKGLEGSVP
AAPDERERWVADSLIGDHLPAPTGPVIDWRRPDEGRVFVTGATGFVGAFLLADLMRHQHVSRVCCLVRAANGEEG
LERLRTGMGKYKLWDEAFAGRLDVVTGRLEDEHLGMGAQQFEAMARWSSVVFHLGARVNYTQPYALHRDANTLGT
VNVVRFSTAGHRLKPLHYVSSISCFGPTGLVTGATTVREDEPLLRHLDALPLDHGYAQSQWVAEQLVGRLISRGF
PIAVYRPGFVTGHSRSGACNRDDFVSRLIEACCEMGCYPLLPNQRKEFVPVDYVTAAILHIAASPTCAGKAYHIV
PPSRDASVDMDATMQLVGEALQRPLRGVPYSEWVDRLAVVAPLRLLPLQPMLAEKIYSGRTRWELYENMPVYDTS
NTDAALADYPGGLELPPLDESLMKRYISFIDEAAREGAAPLSSAVA
Coding >Ophio5|1347
ATGGCCGGACTGTGGGCTTCGATCCTGGCTGCGCCCGTCGGCGGATACTACGACGACGACGACGACTTCATCAGC
CTCGGCGGCTCGTCTCTGCAGGCCTCACTTCTCGTCAGCCAGATACGGCAGACGTTTGGGCTCGAGGTTCCGCTC
TTGACACTGTATCGCGACTTCAGCCTGGGGGCCGTCTCGGCCGTCGTGGCAAAGGGCCTCGAGGGAAGCGTGCCG
GCGGCTCCGGACGAGCGGGAGAGGTGGGTGGCCGATAGCCTCATCGGAGACCATCTTCCGGCGCCGACGGGACCC
GTCATCGACTGGCGGCGTCCCGACGAGGGCCGAGTGTTCGTCACGGGGGCGACGGGCTTCGTCGGCGCCTTCTTG
CTGGCTGATCTGATGCGTCACCAGCACGTCTCCCGCGTCTGCTGTCTCGTGAGGGCGGCCAATGGCGAAGAGGGC
CTCGAACGGCTACGGACCGGTATGGGCAAGTACAAGCTATGGGATGAGGCCTTTGCCGGCCGGCTGGACGTCGTC
ACCGGCCGACTGGAAGACGAACATCTCGGCATGGGGGCCCAACAGTTCGAAGCCATGGCGCGCTGGTCCAGCGTC
GTCTTCCATCTCGGGGCTCGGGTCAACTACACGCAGCCGTACGCGCTCCATCGGGACGCCAACACGCTGGGTACG
GTCAACGTGGTGCGCTTCAGCACGGCCGGCCATCGGCTCAAGCCCCTTCACTACGTCTCGAGCATCTCCTGCTTC
GGCCCGACGGGACTGGTGACGGGGGCGACGACGGTTCGCGAGGATGAGCCGCTGCTGCGACATCTCGATGCCCTG
CCGCTGGATCACGGCTACGCCCAGAGCCAGTGGGTGGCGGAGCAGCTGGTCGGTCGTCTCATCTCCAGGGGGTTC
CCCATCGCCGTCTACCGTCCGGGCTTCGTCACCGGTCACAGCCGCAGCGGGGCCTGCAACCGAGACGACTTCGTC
AGTCGTCTGATCGAAGCCTGCTGCGAGATGGGCTGTTACCCCTTGTTACCCAACCAGCGCAAGGAATTCGTCCCC
GTCGACTACGTCACCGCCGCCATCCTACACATTGCCGCTTCGCCGACGTGTGCGGGAAAGGCGTACCATATCGTT
CCGCCTTCGCGAGACGCTTCCGTCGACATGGACGCCACCATGCAACTCGTCGGCGAAGCCCTTCAACGGCCCTTA
CGAGGCGTCCCCTACTCCGAGTGGGTCGACCGTCTCGCCGTCGTCGCGCCCCTGCGCCTCCTCCCCCTGCAACCG
ATGCTGGCCGAGAAGATTTACAGCGGACGGACCCGGTGGGAGCTCTACGAGAACATGCCCGTCTACGACACGTCC
AATACCGACGCTGCCCTGGCCGACTACCCCGGCGGGCTGGAGTTGCCGCCGCTGGATGAGTCGTTGATGAAGAGG
TATATAAGCTTCATTGACGAGGCGGCGAGGGAGGGGGCTGCGCCGCTTTCGTCGGCGGTTGCG
Transcript >Ophio5|1347
ATGGCCGGACTGTGGGCTTCGATCCTGGCTGCGCCCGTCGGCGGATACTACGACGACGACGACGACTTCATCAGC
CTCGGCGGCTCGTCTCTGCAGGCCTCACTTCTCGTCAGCCAGATACGGCAGACGTTTGGGCTCGAGGTTCCGCTC
TTGACACTGTATCGCGACTTCAGCCTGGGGGCCGTCTCGGCCGTCGTGGCAAAGGGCCTCGAGGGAAGCGTGCCG
GCGGCTCCGGACGAGCGGGAGAGGTGGGTGGCCGATAGCCTCATCGGAGACCATCTTCCGGCGCCGACGGGACCC
GTCATCGACTGGCGGCGTCCCGACGAGGGCCGAGTGTTCGTCACGGGGGCGACGGGCTTCGTCGGCGCCTTCTTG
CTGGCTGATCTGATGCGTCACCAGCACGTCTCCCGCGTCTGCTGTCTCGTGAGGGCGGCCAATGGCGAAGAGGGC
CTCGAACGGCTACGGACCGGTATGGGCAAGTACAAGCTATGGGATGAGGCCTTTGCCGGCCGGCTGGACGTCGTC
ACCGGCCGACTGGAAGACGAACATCTCGGCATGGGGGCCCAACAGTTCGAAGCCATGGCGCGCTGGTCCAGCGTC
GTCTTCCATCTCGGGGCTCGGGTCAACTACACGCAGCCGTACGCGCTCCATCGGGACGCCAACACGCTGGGTACG
GTCAACGTGGTGCGCTTCAGCACGGCCGGCCATCGGCTCAAGCCCCTTCACTACGTCTCGAGCATCTCCTGCTTC
GGCCCGACGGGACTGGTGACGGGGGCGACGACGGTTCGCGAGGATGAGCCGCTGCTGCGACATCTCGATGCCCTG
CCGCTGGATCACGGCTACGCCCAGAGCCAGTGGGTGGCGGAGCAGCTGGTCGGTCGTCTCATCTCCAGGGGGTTC
CCCATCGCCGTCTACCGTCCGGGCTTCGTCACCGGTCACAGCCGCAGCGGGGCCTGCAACCGAGACGACTTCGTC
AGTCGTCTGATCGAAGCCTGCTGCGAGATGGGCTGTTACCCCTTGTTACCCAACCAGCGCAAGGAATTCGTCCCC
GTCGACTACGTCACCGCCGCCATCCTACACATTGCCGCTTCGCCGACGTGTGCGGGAAAGGCGTACCATATCGTT
CCGCCTTCGCGAGACGCTTCCGTCGACATGGACGCCACCATGCAACTCGTCGGCGAAGCCCTTCAACGGCCCTTA
CGAGGCGTCCCCTACTCCGAGTGGGTCGACCGTCTCGCCGTCGTCGCGCCCCTGCGCCTCCTCCCCCTGCAACCG
ATGCTGGCCGAGAAGATTTACAGCGGACGGACCCGGTGGGAGCTCTACGAGAACATGCCCGTCTACGACACGTCC
AATACCGACGCTGCCCTGGCCGACTACCCCGGCGGGCTGGAGTTGCCGCCGCTGGATGAGTCGTTGATGAAGAGG
TATATAAGCTTCATTGACGAGGCGGCGAGGGAGGGGGCTGCGCCGCTTTCGTCGGCGGTTGCGTAA
Gene >Ophio5|1347
ATGGCCGGACTGTGGGCTTCGATCCTGGCTGCGCCCGTCGGCGGATACTACGACGACGACGACGACTTCATCAGC
CTCGGCGGCTCGTCTCTGCAGGCCTCACTTCTCGTCAGCCAGATACGGCAGACGTTTGGGCTCGAGGTTCCGCTC
TTGACACTGTATCGCGACTTCAGCCTGGGGGCCGTCTCGGCCGTCGTGGCAAAGGGCCTCGAGGGAAGCGTGCCG
GCGGCTCCGGACGAGCGGGAGAGGTGGGTGGCCGATAGCCTCATCGGAGACCATCTTCCGGCGCCGACGGGACCC
GTCATCGACTGGCGGCGTCCCGACGAGGGCCGAGTGTTCGTCACGGGGGCGACGGGCTTCGTCGGCGCCTTCTTG
CTGGCTGATCTGATGCGTCACCAGCACGTCTCCCGCGTCTGCTGTCTCGTGAGGGCGGCCAATGGCGAAGAGGGC
CTCGAACGGCTACGGACCGGTATGGGCAAGTACAAGCTATGGGATGAGGCCTTTGCCGGCCGGCTGGACGTCGTC
ACCGGCCGACTGGAAGACGAACATCTCGGCATGGGGGCCCAACAGTTCGAAGCCATGGCGCGCTGGTCCAGCGTC
GTCTTCCATCTCGGGGCTCGGGTCAACTACACGCAGCCGTACGCGCTCCATCGGGACGCCAACACGCTGGGTACG
GTCAACGTGGTGCGCTTCAGCACGGCCGGCCATCGGCTCAAGCCCCTTCACTACGTCTCGAGCATCTCCTGCTTC
GGCCCGACGGGACTGGTGACGGGGGCGACGACGGTTCGCGAGGATGAGCCGCTGCTGCGACATCTCGATGCCCTG
CCGCTGGATCACGGCTACGCCCAGAGCCAGTGGGTGGCGGAGCAGCTGGTCGGTCGTCTCATCTCCAGGGGGTTC
CCCATCGCCGTCTACCGTCCGGGCTTCGTCACCGGTCACAGCCGCAGCGGGGCCTGCAACCGAGACGACTTCGTC
AGTCGTCTGATCGAAGCCTGCTGCGAGATGGGCTGTTACCCCTTGTTACCCAACCAGCGCAAGGAATTCGTCCCC
GTCGACTACGTCACCGCCGCCATCCTACACATTGCCGCTTCGCCGACGTGTGCGGGAAAGGCGTACCATATCGTT
CCGCCTTCGCGAGACGCTTCCGTCGACATGGACGCCACCATGCAACTCGTCGGCGAAGCCCTTCAACGGCCCTTA
CGAGGCGTCCCCTACTCCGAGTGGGTCGACCGTCTCGCCGTCGTCGCGCCCCTGCGCCTCCTCCCCCTGCAACCG
ATGCTGGCCGAGAAGATTTACAGCGGACGGACCCGGTGGGAGCTCTACGAGAACATGCCCGTCTACGACACGTCC
AATACCGACGCTGCCCTGGCCGACTACCCCGGCGGGCTGGAGTTGCCGCCGCTGGATGAGTCGTTGATGAAGAGG
TATATAAGCTTCATTGACGAGGCGGCGAGGGAGGGGGCTGCGCCGCTTTCGTCGGCGGTTGCGTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail