Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1347
Gene name
Locationscaffold_145:1351..2842
Strand-
Gene length (bp)1491
Transcript length (bp)1491
Coding sequence length (bp)1488
Protein length (aa) 496

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07993 NAD_binding_4 Male sterility protein 1.9E-57 114 358
PF00550 PP-binding Phosphopantetheine attachment site 2.1E-08 3 63
PF01370 Epimerase NAD dependent epimerase/dehydratase family 3.0E-08 112 362

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5 410 8.0E-62
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 14 480 2.0E-58
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 23 379 3.0E-46
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 20 367 5.0E-43
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1 369 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q70LM4|LGRD_BREPA Linear gramicidin synthase subunit D OS=Brevibacillus parabrevis GN=lgrD PE=1 SV=1 5 410 8.0E-62
sp|P37693|HETM_NOSS1 Polyketide synthase HetM OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=hetM PE=3 SV=1 14 480 2.0E-58
sp|P40976|LYS2_SCHPO L-2-aminoadipate reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lys1 PE=1 SV=3 23 379 3.0E-46
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 20 367 5.0E-43
sp|O74298|LYS2_PENCH L-2-aminoadipate reductase large subunit OS=Penicillium chrysogenum GN=lys2 PE=3 SV=1 1 369 2.0E-41
sp|P07702|LYS2_YEAST L-2-aminoadipate reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LYS2 PE=1 SV=2 4 365 3.0E-40
sp|Q75BB3|LYS2_ASHGO L-2-aminoadipate reductase large subunit OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=LYS2 PE=3 SV=2 20 412 8.0E-40
sp|Q12572|LYS2_CANAX L-2-aminoadipate reductase large subunit OS=Candida albicans GN=LYS2 PE=3 SV=2 111 365 2.0E-38
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 102 371 3.0E-23
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 82 371 2.0E-20
sp|Q6RKB1|CAR_NOCIO Carboxylic acid reductase OS=Nocardia iowensis GN=car PE=1 SV=1 79 422 4.0E-20
sp|B2HN69|CAR_MYCMM Carboxylic acid reductase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=car PE=1 SV=1 20 422 8.0E-18
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 22 410 2.0E-17
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 103 339 1.0E-15
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 112 367 2.0E-14
sp|O74419|YQ52_SCHPO Uncharacterized protein C162.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC162.02c PE=2 SV=1 107 339 1.0E-13
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 112 367 3.0E-13
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 112 370 2.0E-12
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 106 339 2.0E-12
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 328 2.0E-12
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 97 355 3.0E-11
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 113 339 1.0E-09
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 105 344 6.0E-09
sp|A1ZAI3|FACR2_DROME Putative fatty acyl-CoA reductase CG8303 OS=Drosophila melanogaster GN=CG8303 PE=2 SV=2 111 359 4.0E-08
sp|A1ZAI5|FACR1_DROME Putative fatty acyl-CoA reductase CG5065 OS=Drosophila melanogaster GN=CG5065 PE=3 SV=1 112 312 5.0E-08
sp|Q08891|FACR2_ARATH Fatty acyl-CoA reductase 2 OS=Arabidopsis thaliana GN=FAR2 PE=2 SV=2 109 232 5.0E-07
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 92 4.0E-06
sp|Q70LM5|LGRC_BREPA Linear gramicidin synthase subunit C OS=Brevibacillus parabrevis GN=lgrC PE=3 SV=1 1 94 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1347
MAGLWASILAAPVGGYYDDDDDFISLGGSSLQASLLVSQIRQTFGLEVPLLTLYRDFSLGAVSAVVAKGLEGSVP
AAPDERERWVADSLIGDHLPAPTGPVIDWRRPDEGRVFVTGATGFVGAFLLADLMRHQHVSRVCCLVRAANGEEG
LERLRTGMGKYKLWDEAFAGRLDVVTGRLEDEHLGMGAQQFEAMARWSSVVFHLGARVNYTQPYALHRDANTLGT
VNVVRFSTAGHRLKPLHYVSSISCFGPTGLVTGATTVREDEPLLRHLDALPLDHGYAQSQWVAEQLVGRLISRGF
PIAVYRPGFVTGHSRSGACNRDDFVSRLIEACCEMGCYPLLPNQRKEFVPVDYVTAAILHIAASPTCAGKAYHIV
PPSRDASVDMDATMQLVGEALQRPLRGVPYSEWVDRLAVVAPLRLLPLQPMLAEKIYSGRTRWELYENMPVYDTS
NTDAALADYPGGLELPPLDESLMKRYISFIDEAAREGAAPLSSAVA
Coding >Ophio5|1347
ATGGCCGGACTGTGGGCTTCGATCCTGGCTGCGCCCGTCGGCGGATACTACGACGACGACGACGACTTCATCAGC
CTCGGCGGCTCGTCTCTGCAGGCCTCACTTCTCGTCAGCCAGATACGGCAGACGTTTGGGCTCGAGGTTCCGCTC
TTGACACTGTATCGCGACTTCAGCCTGGGGGCCGTCTCGGCCGTCGTGGCAAAGGGCCTCGAGGGAAGCGTGCCG
GCGGCTCCGGACGAGCGGGAGAGGTGGGTGGCCGATAGCCTCATCGGAGACCATCTTCCGGCGCCGACGGGACCC
GTCATCGACTGGCGGCGTCCCGACGAGGGCCGAGTGTTCGTCACGGGGGCGACGGGCTTCGTCGGCGCCTTCTTG
CTGGCTGATCTGATGCGTCACCAGCACGTCTCCCGCGTCTGCTGTCTCGTGAGGGCGGCCAATGGCGAAGAGGGC
CTCGAACGGCTACGGACCGGTATGGGCAAGTACAAGCTATGGGATGAGGCCTTTGCCGGCCGGCTGGACGTCGTC
ACCGGCCGACTGGAAGACGAACATCTCGGCATGGGGGCCCAACAGTTCGAAGCCATGGCGCGCTGGTCCAGCGTC
GTCTTCCATCTCGGGGCTCGGGTCAACTACACGCAGCCGTACGCGCTCCATCGGGACGCCAACACGCTGGGTACG
GTCAACGTGGTGCGCTTCAGCACGGCCGGCCATCGGCTCAAGCCCCTTCACTACGTCTCGAGCATCTCCTGCTTC
GGCCCGACGGGACTGGTGACGGGGGCGACGACGGTTCGCGAGGATGAGCCGCTGCTGCGACATCTCGATGCCCTG
CCGCTGGATCACGGCTACGCCCAGAGCCAGTGGGTGGCGGAGCAGCTGGTCGGTCGTCTCATCTCCAGGGGGTTC
CCCATCGCCGTCTACCGTCCGGGCTTCGTCACCGGTCACAGCCGCAGCGGGGCCTGCAACCGAGACGACTTCGTC
AGTCGTCTGATCGAAGCCTGCTGCGAGATGGGCTGTTACCCCTTGTTACCCAACCAGCGCAAGGAATTCGTCCCC
GTCGACTACGTCACCGCCGCCATCCTACACATTGCCGCTTCGCCGACGTGTGCGGGAAAGGCGTACCATATCGTT
CCGCCTTCGCGAGACGCTTCCGTCGACATGGACGCCACCATGCAACTCGTCGGCGAAGCCCTTCAACGGCCCTTA
CGAGGCGTCCCCTACTCCGAGTGGGTCGACCGTCTCGCCGTCGTCGCGCCCCTGCGCCTCCTCCCCCTGCAACCG
ATGCTGGCCGAGAAGATTTACAGCGGACGGACCCGGTGGGAGCTCTACGAGAACATGCCCGTCTACGACACGTCC
AATACCGACGCTGCCCTGGCCGACTACCCCGGCGGGCTGGAGTTGCCGCCGCTGGATGAGTCGTTGATGAAGAGG
TATATAAGCTTCATTGACGAGGCGGCGAGGGAGGGGGCTGCGCCGCTTTCGTCGGCGGTTGCG
Transcript >Ophio5|1347
ATGGCCGGACTGTGGGCTTCGATCCTGGCTGCGCCCGTCGGCGGATACTACGACGACGACGACGACTTCATCAGC
CTCGGCGGCTCGTCTCTGCAGGCCTCACTTCTCGTCAGCCAGATACGGCAGACGTTTGGGCTCGAGGTTCCGCTC
TTGACACTGTATCGCGACTTCAGCCTGGGGGCCGTCTCGGCCGTCGTGGCAAAGGGCCTCGAGGGAAGCGTGCCG
GCGGCTCCGGACGAGCGGGAGAGGTGGGTGGCCGATAGCCTCATCGGAGACCATCTTCCGGCGCCGACGGGACCC
GTCATCGACTGGCGGCGTCCCGACGAGGGCCGAGTGTTCGTCACGGGGGCGACGGGCTTCGTCGGCGCCTTCTTG
CTGGCTGATCTGATGCGTCACCAGCACGTCTCCCGCGTCTGCTGTCTCGTGAGGGCGGCCAATGGCGAAGAGGGC
CTCGAACGGCTACGGACCGGTATGGGCAAGTACAAGCTATGGGATGAGGCCTTTGCCGGCCGGCTGGACGTCGTC
ACCGGCCGACTGGAAGACGAACATCTCGGCATGGGGGCCCAACAGTTCGAAGCCATGGCGCGCTGGTCCAGCGTC
GTCTTCCATCTCGGGGCTCGGGTCAACTACACGCAGCCGTACGCGCTCCATCGGGACGCCAACACGCTGGGTACG
GTCAACGTGGTGCGCTTCAGCACGGCCGGCCATCGGCTCAAGCCCCTTCACTACGTCTCGAGCATCTCCTGCTTC
GGCCCGACGGGACTGGTGACGGGGGCGACGACGGTTCGCGAGGATGAGCCGCTGCTGCGACATCTCGATGCCCTG
CCGCTGGATCACGGCTACGCCCAGAGCCAGTGGGTGGCGGAGCAGCTGGTCGGTCGTCTCATCTCCAGGGGGTTC
CCCATCGCCGTCTACCGTCCGGGCTTCGTCACCGGTCACAGCCGCAGCGGGGCCTGCAACCGAGACGACTTCGTC
AGTCGTCTGATCGAAGCCTGCTGCGAGATGGGCTGTTACCCCTTGTTACCCAACCAGCGCAAGGAATTCGTCCCC
GTCGACTACGTCACCGCCGCCATCCTACACATTGCCGCTTCGCCGACGTGTGCGGGAAAGGCGTACCATATCGTT
CCGCCTTCGCGAGACGCTTCCGTCGACATGGACGCCACCATGCAACTCGTCGGCGAAGCCCTTCAACGGCCCTTA
CGAGGCGTCCCCTACTCCGAGTGGGTCGACCGTCTCGCCGTCGTCGCGCCCCTGCGCCTCCTCCCCCTGCAACCG
ATGCTGGCCGAGAAGATTTACAGCGGACGGACCCGGTGGGAGCTCTACGAGAACATGCCCGTCTACGACACGTCC
AATACCGACGCTGCCCTGGCCGACTACCCCGGCGGGCTGGAGTTGCCGCCGCTGGATGAGTCGTTGATGAAGAGG
TATATAAGCTTCATTGACGAGGCGGCGAGGGAGGGGGCTGCGCCGCTTTCGTCGGCGGTTGCGTAA
Gene >Ophio5|1347
ATGGCCGGACTGTGGGCTTCGATCCTGGCTGCGCCCGTCGGCGGATACTACGACGACGACGACGACTTCATCAGC
CTCGGCGGCTCGTCTCTGCAGGCCTCACTTCTCGTCAGCCAGATACGGCAGACGTTTGGGCTCGAGGTTCCGCTC
TTGACACTGTATCGCGACTTCAGCCTGGGGGCCGTCTCGGCCGTCGTGGCAAAGGGCCTCGAGGGAAGCGTGCCG
GCGGCTCCGGACGAGCGGGAGAGGTGGGTGGCCGATAGCCTCATCGGAGACCATCTTCCGGCGCCGACGGGACCC
GTCATCGACTGGCGGCGTCCCGACGAGGGCCGAGTGTTCGTCACGGGGGCGACGGGCTTCGTCGGCGCCTTCTTG
CTGGCTGATCTGATGCGTCACCAGCACGTCTCCCGCGTCTGCTGTCTCGTGAGGGCGGCCAATGGCGAAGAGGGC
CTCGAACGGCTACGGACCGGTATGGGCAAGTACAAGCTATGGGATGAGGCCTTTGCCGGCCGGCTGGACGTCGTC
ACCGGCCGACTGGAAGACGAACATCTCGGCATGGGGGCCCAACAGTTCGAAGCCATGGCGCGCTGGTCCAGCGTC
GTCTTCCATCTCGGGGCTCGGGTCAACTACACGCAGCCGTACGCGCTCCATCGGGACGCCAACACGCTGGGTACG
GTCAACGTGGTGCGCTTCAGCACGGCCGGCCATCGGCTCAAGCCCCTTCACTACGTCTCGAGCATCTCCTGCTTC
GGCCCGACGGGACTGGTGACGGGGGCGACGACGGTTCGCGAGGATGAGCCGCTGCTGCGACATCTCGATGCCCTG
CCGCTGGATCACGGCTACGCCCAGAGCCAGTGGGTGGCGGAGCAGCTGGTCGGTCGTCTCATCTCCAGGGGGTTC
CCCATCGCCGTCTACCGTCCGGGCTTCGTCACCGGTCACAGCCGCAGCGGGGCCTGCAACCGAGACGACTTCGTC
AGTCGTCTGATCGAAGCCTGCTGCGAGATGGGCTGTTACCCCTTGTTACCCAACCAGCGCAAGGAATTCGTCCCC
GTCGACTACGTCACCGCCGCCATCCTACACATTGCCGCTTCGCCGACGTGTGCGGGAAAGGCGTACCATATCGTT
CCGCCTTCGCGAGACGCTTCCGTCGACATGGACGCCACCATGCAACTCGTCGGCGAAGCCCTTCAACGGCCCTTA
CGAGGCGTCCCCTACTCCGAGTGGGTCGACCGTCTCGCCGTCGTCGCGCCCCTGCGCCTCCTCCCCCTGCAACCG
ATGCTGGCCGAGAAGATTTACAGCGGACGGACCCGGTGGGAGCTCTACGAGAACATGCCCGTCTACGACACGTCC
AATACCGACGCTGCCCTGGCCGACTACCCCGGCGGGCTGGAGTTGCCGCCGCTGGATGAGTCGTTGATGAAGAGG
TATATAAGCTTCATTGACGAGGCGGCGAGGGAGGGGGCTGCGCCGCTTTCGTCGGCGGTTGCGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail