Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1340
Gene name
Locationscaffold_144:28092..30597
Strand-
Gene length (bp)2505
Transcript length (bp)2352
Coding sequence length (bp)2349
Protein length (aa) 783

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09359 VTC VTC domain 8.5E-97 205 478
PF02656 DUF202 Domain of unknown function (DUF202) 3.4E-12 678 742

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 1 773 0.0E+00
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 1 772 0.0E+00
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 1 515 2.0E-80
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 498 2.0E-68
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 498 3.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P47075|VTC4_YEAST Vacuolar transporter chaperone 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC4 PE=1 SV=2 1 773 0.0E+00
sp|P78810|VTC4_SCHPO Vacuolar transporter chaperone 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc4 PE=1 SV=2 1 772 0.0E+00
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 1 515 2.0E-80
sp|Q02725|VTC3_YEAST Vacuolar transporter chaperone 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC3 PE=1 SV=1 1 498 2.0E-68
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 1 498 3.0E-67
sp|Q9UR17|VTC1_SCHPO Vacuolar transporter chaperone 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrf1 PE=2 SV=1 658 775 5.0E-30
sp|P40046|VTC1_YEAST Vacuolar transporter chaperone 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC1 PE=1 SV=3 665 773 2.0E-24
sp|O13718|VTC2_SCHPO Vacuolar transporter chaperone 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vtc2 PE=1 SV=1 651 779 4.0E-14
sp|Q8LBH4|SPX1_ARATH SPX domain-containing protein 1 OS=Arabidopsis thaliana GN=SPX1 PE=2 SV=2 1 178 3.0E-09
sp|P43585|VTC2_YEAST Vacuolar transporter chaperone 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=VTC2 PE=1 SV=1 646 778 6.0E-09
sp|Q7Y0F6|SPX5_ORYSJ SPX domain-containing protein 5 OS=Oryza sativa subsp. japonica GN=SPX5 PE=2 SV=1 1 176 2.0E-07
sp|A2XHU0|SPX5_ORYSI SPX domain-containing protein 5 OS=Oryza sativa subsp. indica GN=SPX5 PE=3 SV=1 1 176 2.0E-07
sp|Q5PP62|SPX3_ARATH SPX domain-containing protein 3 OS=Arabidopsis thaliana GN=SPX3 PE=2 SV=1 1 205 4.0E-07
sp|A2X254|SPX2_ORYSI SPX domain-containing protein 2 OS=Oryza sativa subsp. indica GN=SPX2 PE=3 SV=1 1 176 8.0E-07
sp|Q6Z784|SPX2_ORYSJ SPX domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=SPX2 PE=2 SV=1 1 176 9.0E-07
sp|Q94A21|SPX4_ARATH SPX domain-containing protein 4 OS=Arabidopsis thaliana GN=SPX4 PE=2 SV=1 1 166 1.0E-06
sp|O59712|YBH4_SCHPO Uncharacterized transporter C3B8.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.04c PE=3 SV=1 107 165 3.0E-06
sp|O48781|SPX2_ARATH SPX domain-containing protein 2 OS=Arabidopsis thaliana GN=SPX2 PE=2 SV=1 50 199 5.0E-06
sp|A8DZH4|XPR1_DANRE Xenotropic and polytropic retrovirus receptor 1 homolog OS=Danio rerio GN=xpr1 PE=3 SV=1 1 147 7.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 59 0.45

Transmembrane Domains

Domain # Start End Length
1 687 709 22
2 716 738 22
3 753 775 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
SC16a Pure fungal culture 34.55 18.95 50.14
CcL In ants, during behavior modification 76.83 38.78 114.89
CcD In ants, recently dead 65.26 34.85 95.67

Differential expression

Label1 Label2 Q-value Significant difference
SC16a CcL 0.001217 yes
SC16a CcD 0.004113 yes
CcL CcD 0.535174 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1340
MKFGEQLRSSVIREYQWYYIDYNGLKAELKNATGPSKADAVGGREWTEDDETRFVGKLEDELEKVHTKQQVKAME
ISRRIAVSEREVRDVVNRLNERGLGDEGPSEEEFQLLEEDLGDIIAEVHDLAKFVQLNYTGFYKIIKKHDKMTGW
HLRPAFETRLKAKPFYKENYETSVIKLSTLYDLVRTRGNPVQGDSAAGGSQASFVRQTTKYWVHPDNVTELKLII
LKHLPVLVFNAGKAFEQQDSAITSIYYDNPDSWDLYEGRLKKTEGAEAIRLRWYGGMQTENIFVERKTHREDWTG
EKSVKARFSIKEKNVNAYLRGELLPAAMFEKARREGRKSEKAIAEDERLASEIQYAVLAKGYRPVCRSFYNRTAF
QLPADARVRISLDTELTMIREDNLDGRSRCGDNWRRMDIGIDYPFAQLAPEDIVRFPYAVLEVKLQTQLGQEPPA
WVRQLISSHLVEAVPKFSKFIHGAACLFPDRIHLLPFWMPQMDVDIRKPVTHDFGIRRRPGTAGTTTTSSEDDED
LDSDVDDNAAANSGERPGRPSSAPQPAAAAVTGRASTNGGADTEGQTTDGVAADDDDYPIYDSDDEYDENYALEE
ARRVGGWHYYSILVATKGRALGRGAISVAKRLTPGPRPSRIPPTQRHQMLFGSEAVQQRKFRAPPGKKIYVPVRV
EPKVYFAAERTFLGWLEYSIYIGAIAVTLLNFGSQTSSPSFWTAAVFTLLAILSLAYSVTIYLYRSRAIRKRTAA
KYYDRWGPSVLCLALFVAVAMNFAFSGRERGVW
Coding >Ophio5|1340
ATGAAGTTCGGCGAACAGCTGCGTTCGAGCGTAATACGCGAGTATCAATGGTATTACATCGACTACAACGGTCTC
AAGGCCGAGCTTAAGAACGCCACGGGCCCCTCCAAGGCCGATGCCGTGGGCGGCAGGGAATGGACCGAGGATGAC
GAGACGCGCTTCGTGGGCAAGCTCGAGGATGAGCTCGAAAAGGTCCACACGAAGCAGCAGGTCAAGGCCATGGAG
ATCTCGCGCCGTATCGCCGTCAGCGAGCGCGAGGTTCGCGATGTCGTCAACCGCCTCAATGAACGCGGCCTCGGT
GACGAAGGGCCCTCGGAGGAGGAGTTCCAGCTGCTGGAGGAGGACCTCGGGGATATCATCGCCGAGGTTCACGAC
CTCGCCAAGTTTGTCCAGCTCAATTATACCGGATTCTACAAGATTATCAAGAAGCACGACAAAATGACGGGCTGG
CACCTTCGGCCGGCGTTTGAAACGCGTCTCAAGGCCAAGCCCTTTTACAAGGAAAACTACGAGACGTCTGTCATC
AAGCTTTCGACGCTCTACGACCTGGTCCGTACGCGCGGGAACCCAGTACAGGGCGACAGTGCCGCCGGCGGCTCT
CAGGCAAGCTTCGTGCGCCAGACGACCAAATACTGGGTGCATCCGGACAACGTGACGGAGCTGAAGCTCATCATC
CTCAAGCACCTGCCCGTTCTCGTCTTCAACGCCGGCAAGGCATTCGAGCAGCAGGACTCGGCCATCACGTCCATC
TACTACGACAATCCCGACAGCTGGGACCTGTACGAGGGCCGGCTGAAGAAGACGGAGGGCGCCGAGGCCATCCGT
CTCCGCTGGTACGGCGGCATGCAGACCGAGAACATCTTTGTCGAGCGCAAGACTCACCGCGAGGACTGGACGGGC
GAGAAGTCGGTCAAGGCCCGCTTCTCCATCAAGGAGAAGAATGTCAATGCCTACCTCAGGGGCGAGCTGCTCCCC
GCCGCCATGTTCGAAAAGGCCCGTAGAGAGGGCCGCAAGTCGGAAAAAGCCATCGCCGAGGACGAGAGGCTGGCG
TCGGAGATCCAGTACGCGGTCCTGGCCAAGGGCTATCGACCCGTCTGCCGCTCCTTTTACAACCGAACCGCCTTC
CAGCTCCCGGCCGACGCCCGGGTTCGCATCTCGCTCGACACCGAGCTGACCATGATCCGCGAAGACAACCTCGAC
GGCCGGAGCCGCTGCGGCGACAACTGGCGCCGGATGGACATTGGCATCGACTATCCCTTCGCCCAACTAGCCCCC
GAAGACATCGTCCGCTTCCCCTACGCCGTCCTCGAGGTCAAGCTCCAGACGCAGCTGGGACAGGAGCCCCCGGCT
TGGGTACGACAGCTCATCTCGTCACACCTGGTCGAGGCGGTGCCCAAGTTCTCCAAGTTCATCCACGGCGCGGCC
TGCCTGTTCCCGGACCGGATTCACCTGCTGCCGTTCTGGATGCCGCAGATGGATGTTGATATTCGTAAGCCCGTC
ACGCACGATTTCGGCATCCGCCGGAGACCCGGAACGGCGGGAACGACGACGACGTCGTCCGAGGACGACGAGGAT
CTGGACTCGGACGTAGACGACAACGCCGCCGCCAACAGCGGAGAGAGGCCAGGCCGGCCCTCGAGCGCCCCGCAA
CCGGCCGCCGCCGCCGTCACGGGTCGGGCTTCGACGAACGGGGGGGCCGACACCGAGGGCCAGACGACAGACGGC
GTAGCAGCCGACGACGACGACTACCCCATCTACGACTCGGACGACGAGTACGACGAAAACTACGCGCTCGAGGAG
GCACGACGCGTCGGCGGCTGGCACTACTACTCGATCCTAGTCGCCACCAAAGGCCGAGCCCTGGGCCGCGGCGCC
ATCAGCGTGGCCAAGAGGTTGACTCCCGGTCCTCGACCGTCTCGCATCCCGCCCACGCAGCGTCACCAGATGCTC
TTCGGCTCCGAGGCCGTGCAGCAGAGGAAGTTTCGCGCGCCGCCGGGCAAGAAGATTTACGTGCCGGTGCGGGTC
GAGCCCAAGGTTTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGCTCGAGTATTCCATCTACATCGGCGCCATC
GCCGTCACGCTCCTCAACTTCGGATCGCAGACGTCGTCGCCATCATTCTGGACGGCGGCCGTCTTCACCCTCCTC
GCCATCCTGAGCTTGGCCTACTCGGTCACCATCTATCTCTATCGAAGCCGGGCGATTCGCAAACGGACCGCCGCC
AAGTATTACGATAGGTGGGGGCCGTCGGTCTTATGCCTCGCCCTCTTCGTCGCCGTGGCAATGAATTTTGCCTTT
TCCGGACGTGAGAGGGGCGTGTGG
Transcript >Ophio5|1340
ATGAAGTTCGGCGAACAGCTGCGTTCGAGCGTAATACGCGAGTATCAATGGTATTACATCGACTACAACGGTCTC
AAGGCCGAGCTTAAGAACGCCACGGGCCCCTCCAAGGCCGATGCCGTGGGCGGCAGGGAATGGACCGAGGATGAC
GAGACGCGCTTCGTGGGCAAGCTCGAGGATGAGCTCGAAAAGGTCCACACGAAGCAGCAGGTCAAGGCCATGGAG
ATCTCGCGCCGTATCGCCGTCAGCGAGCGCGAGGTTCGCGATGTCGTCAACCGCCTCAATGAACGCGGCCTCGGT
GACGAAGGGCCCTCGGAGGAGGAGTTCCAGCTGCTGGAGGAGGACCTCGGGGATATCATCGCCGAGGTTCACGAC
CTCGCCAAGTTTGTCCAGCTCAATTATACCGGATTCTACAAGATTATCAAGAAGCACGACAAAATGACGGGCTGG
CACCTTCGGCCGGCGTTTGAAACGCGTCTCAAGGCCAAGCCCTTTTACAAGGAAAACTACGAGACGTCTGTCATC
AAGCTTTCGACGCTCTACGACCTGGTCCGTACGCGCGGGAACCCAGTACAGGGCGACAGTGCCGCCGGCGGCTCT
CAGGCAAGCTTCGTGCGCCAGACGACCAAATACTGGGTGCATCCGGACAACGTGACGGAGCTGAAGCTCATCATC
CTCAAGCACCTGCCCGTTCTCGTCTTCAACGCCGGCAAGGCATTCGAGCAGCAGGACTCGGCCATCACGTCCATC
TACTACGACAATCCCGACAGCTGGGACCTGTACGAGGGCCGGCTGAAGAAGACGGAGGGCGCCGAGGCCATCCGT
CTCCGCTGGTACGGCGGCATGCAGACCGAGAACATCTTTGTCGAGCGCAAGACTCACCGCGAGGACTGGACGGGC
GAGAAGTCGGTCAAGGCCCGCTTCTCCATCAAGGAGAAGAATGTCAATGCCTACCTCAGGGGCGAGCTGCTCCCC
GCCGCCATGTTCGAAAAGGCCCGTAGAGAGGGCCGCAAGTCGGAAAAAGCCATCGCCGAGGACGAGAGGCTGGCG
TCGGAGATCCAGTACGCGGTCCTGGCCAAGGGCTATCGACCCGTCTGCCGCTCCTTTTACAACCGAACCGCCTTC
CAGCTCCCGGCCGACGCCCGGGTTCGCATCTCGCTCGACACCGAGCTGACCATGATCCGCGAAGACAACCTCGAC
GGCCGGAGCCGCTGCGGCGACAACTGGCGCCGGATGGACATTGGCATCGACTATCCCTTCGCCCAACTAGCCCCC
GAAGACATCGTCCGCTTCCCCTACGCCGTCCTCGAGGTCAAGCTCCAGACGCAGCTGGGACAGGAGCCCCCGGCT
TGGGTACGACAGCTCATCTCGTCACACCTGGTCGAGGCGGTGCCCAAGTTCTCCAAGTTCATCCACGGCGCGGCC
TGCCTGTTCCCGGACCGGATTCACCTGCTGCCGTTCTGGATGCCGCAGATGGATGTTGATATTCGTAAGCCCGTC
ACGCACGATTTCGGCATCCGCCGGAGACCCGGAACGGCGGGAACGACGACGACGTCGTCCGAGGACGACGAGGAT
CTGGACTCGGACGTAGACGACAACGCCGCCGCCAACAGCGGAGAGAGGCCAGGCCGGCCCTCGAGCGCCCCGCAA
CCGGCCGCCGCCGCCGTCACGGGTCGGGCTTCGACGAACGGGGGGGCCGACACCGAGGGCCAGACGACAGACGGC
GTAGCAGCCGACGACGACGACTACCCCATCTACGACTCGGACGACGAGTACGACGAAAACTACGCGCTCGAGGAG
GCACGACGCGTCGGCGGCTGGCACTACTACTCGATCCTAGTCGCCACCAAAGGCCGAGCCCTGGGCCGCGGCGCC
ATCAGCGTGGCCAAGAGGTTGACTCCCGGTCCTCGACCGTCTCGCATCCCGCCCACGCAGCGTCACCAGATGCTC
TTCGGCTCCGAGGCCGTGCAGCAGAGGAAGTTTCGCGCGCCGCCGGGCAAGAAGATTTACGTGCCGGTGCGGGTC
GAGCCCAAGGTTTACTTTGCCGCCGAGCGGACCTTTCTCGGATGGCTCGAGTATTCCATCTACATCGGCGCCATC
GCCGTCACGCTCCTCAACTTCGGATCGCAGACGTCGTCGCCATCATTCTGGACGGCGGCCGTCTTCACCCTCCTC
GCCATCCTGAGCTTGGCCTACTCGGTCACCATCTATCTCTATCGAAGCCGGGCGATTCGCAAACGGACCGCCGCC
AAGTATTACGATAGGTGGGGGCCGTCGGTCTTATGCCTCGCCCTCTTCGTCGCCGTGGCAATGAATTTTGCCTTT
TCCGGACGTGAGAGGGGCGTGTGGTGA
Gene >Ophio5|1340
ATGAAGTTCGGCGAACAGCTGCGTTCGAGCGTAATACGCGAGTATCAATGGTATTACATCGACTACAACGGTCTC
AAGGCCGAGCTTAAGAACGCCACGGGCCCCTCCAAGGCCGATGCCGTGGGCGGCAGGGAATGGACCGAGGATGAC
GAGACGCGCTTCGTGGGCAAGCTCGAGGATGAGCTCGAAAAGGTCCACACGAAGCAGCAGGTCAAGGCCATGGAG
ATCTCGCGCCGTATCGCCGTCAGCGAGCGCGAGGTTCGCGATGTCGTCAACCGCCTCAATGAACGCGGCCTCGGT
GACGAAGGGCCCTCGGAGGAGGAGTTCCAGCTGCTGGAGGAGGACCTCGGGGATATCATCGCCGAGGTTCACGAC
CTCGCCAAGTTTGTCCAGCTCAATTATACCGGATTCTACAAGATTATCAAGAAGCACGACGTGAGTCGCTCTCCC
TCTTTTGCTGGGTGCCCCTGACTGACCGCCTCAAGAAAATGACGGGCTGGCACCTTCGGCCGGCGTTTGAAACGC
GTCTCAAGGCCAAGCCCTTTTACAAGGAAAACTACGAGACGTCTGTCATCAAGCTTTCGACGCTCTACGACCTGG
TCCGTACGCGCGGGAACCCAGTACAGGGCGACAGTGCCGCCGGCGGCTCTCAGGCAAGCTTCGTGCGCCAGACGA
CCAAATACTGGGTGCATCCGGACAACGTGACGGAGCTGAAGCTCATCATCCTCAAGCACCTGCCCGTTCTCGTCT
TCAACGCCGGCAAGGCATTCGAGCAGCAGGACTCGGCCATCACGTCCATCTACTACGACAATCCCGACAGCTGGG
ACCTGTACGAGGGCCGGCTGAAGAAGACGGAGGGCGCCGAGGCCATCCGTCTCCGCTGGTACGGCGGCATGCAGA
CCGAGAACATCTTTGTCGAGCGCAAGACTCACCGCGAGGACTGGACGGGCGAGAAGTCGGTCAAGGCCCGCTTCT
CCATCAAGGAGAAGAATGTCAATGCCTACCTCAGGGGCGAGCTGCTCCCCGCCGCCATGTTCGAAAAGGCCCGTA
GAGAGGGCCGCAAGTCGGAAAAAGCCATCGCCGAGGACGAGAGGCTGGCGTCGGAGATCCAGTACGCGGTCCTGG
CCAAGGGCTATCGACCCGTCTGCCGCTCCTTTTACAACCGAACCGCCTTCCAGCTCCCGGCCGACGCCCGGGTTC
GCATCTCGCTCGACACCGAGCTGACCATGATCCGCGAAGACAACCTCGACGGCCGGAGCCGCTGCGGCGACAACT
GGCGCCGGATGGACATTGGCATCGACTATCCCTTCGCCCAACTAGCCCCCGAAGACATCGTCCGCTTCCCCTACG
CCGTCCTCGAGGTCAAGCTCCAGACGCAGCTGGGACAGGAGCCCCCGGCTTGGGTACGACAGCTCATCTCGTCAC
ACCTGGTCGAGGCGGTGCCCAAGTTCTCCAAGTTCATCCACGGCGCGGCCTGCCTGTTCCCGGACCGGATTCACC
TGCTGCCGTTCTGGATGCCGCAGATGGATGTTGATATTCGTAAGCCCGTCACGCACGATTTCGGCATCCGCCGGA
GACCCGGAACGGCGGGAACGACGACGACGTCGTCCGAGGACGACGAGGATCTGGACTCGGACGTAGACGACAACG
CCGCCGCCAACAGCGGAGAGAGGCCAGGCCGGCCCTCGAGCGCCCCGCAACCGGCCGCCGCCGCCGTCACGGGTC
GGGCTTCGACGAACGGGGGGGCCGACACCGAGGGCCAGACGACAGACGGCGTAGCAGCCGACGACGACGACTACC
CCATCTACGACTCGGACGACGAGTACGACGAAAACTACGCGCTCGAGGAGGCACGACGCGTCGGCGGCTGGCACT
ACTACTCGATCCTAGTCGCCACCAAAGGCCGAGCCCTGGGCCGCGGCGCCATCAGCGTGGCCAAGAGGTTGACTC
CCGGTCCTCGACCGTCTCGCATCCCGCCCACGCAGCGTCACCAGATGCTCTTCGGCTCCGAGGCCGTGCAGCAGA
GGAAGTTTCGCGCGCCGCCGGGCAAGAAGATTTACGTGCCGGTGCGGGTCGAGCCCAAGGTTTACTTTGCCGCCG
AGCGGACCTTTCTCGGATGGGTGAGTTTTTTCTCTTGTGTTCCCTAAATTTATTTTATTTTATTTATTTATATCT
TTGGCCCCCTTCTTTTTTTTCATCATACTGATGAAGTATCCGTGACAGCTCGAGTATTCCATCTACATCGGCGCC
ATCGCCGTCACGCTCCTCAACTTCGGATCGCAGACGTCGTCGCCATCATTCTGGACGGCGGCCGTCTTCACCCTC
CTCGCCATCCTGAGCTTGGCCTACTCGGTCACCATCTATCTCTATCGAAGCCGGGCGATTCGCAAACGGACCGCC
GCCAAGTATTACGATAGGTGGGGGCCGTCGGTCTTATGCCTCGCCCTCTTCGTCGCCGTGGCAATGAATTTTGCC
TTTTCCGGACGTGAGAGGGGCGTGTGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail