Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1333
Gene name
Locationscaffold_144:6982..9036
Strand-
Gene length (bp)2054
Transcript length (bp)1890
Coding sequence length (bp)1887
Protein length (aa) 629

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04825 Rad21_Rec8_N N terminus of Rad21 / Rec8 like protein 1.9E-37 1 98
PF04824 Rad21_Rec8 Conserved region of Rad21 / Rec8 like protein 7.0E-09 544 581

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P30776|RAD21_SCHPO Cohesin subunit rad21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad21 PE=1 SV=1 1 213 5.0E-32
sp|Q61550|RAD21_MOUSE Double-strand-break repair protein rad21 homolog OS=Mus musculus GN=Rad21 PE=1 SV=3 1 177 3.0E-29
sp|O93310|RAD21_XENLA Double-strand-break repair protein rad21 homolog OS=Xenopus laevis GN=rad21 PE=1 SV=1 1 177 3.0E-29
sp|O60216|RAD21_HUMAN Double-strand-break repair protein rad21 homolog OS=Homo sapiens GN=RAD21 PE=1 SV=2 1 177 3.0E-29
sp|Q3SWX9|RAD21_BOVIN Double-strand-break repair protein rad21 homolog OS=Bos taurus GN=RAD21 PE=2 SV=1 1 177 3.0E-29
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P30776|RAD21_SCHPO Cohesin subunit rad21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad21 PE=1 SV=1 1 213 5.0E-32
sp|Q61550|RAD21_MOUSE Double-strand-break repair protein rad21 homolog OS=Mus musculus GN=Rad21 PE=1 SV=3 1 177 3.0E-29
sp|O93310|RAD21_XENLA Double-strand-break repair protein rad21 homolog OS=Xenopus laevis GN=rad21 PE=1 SV=1 1 177 3.0E-29
sp|O60216|RAD21_HUMAN Double-strand-break repair protein rad21 homolog OS=Homo sapiens GN=RAD21 PE=1 SV=2 1 177 3.0E-29
sp|Q3SWX9|RAD21_BOVIN Double-strand-break repair protein rad21 homolog OS=Bos taurus GN=RAD21 PE=2 SV=1 1 177 3.0E-29
sp|Q8W1Y0|SSC14_ARATH Sister chromatid cohesion 1 protein 4 OS=Arabidopsis thaliana GN=SYN4 PE=2 SV=1 1 125 2.0E-27
sp|A2AU37|RD21L_MOUSE Double-strand-break repair protein rad21-like protein 1 OS=Mus musculus GN=Rad21l1 PE=1 SV=2 1 177 3.0E-25
sp|Q9H4I0|RD21L_HUMAN Double-strand-break repair protein rad21-like protein 1 OS=Homo sapiens GN=RAD21L1 PE=2 SV=3 1 171 4.0E-25
sp|D2HSB3|RD21L_AILME Double-strand-break repair protein rad21-like protein 1 OS=Ailuropoda melanoleuca GN=RAD21L1 PE=3 SV=1 1 120 4.0E-25
sp|Q19325|SCC1_CAEEL Sister chromatid cohesion protein 1 OS=Caenorhabditis elegans GN=scc-1 PE=1 SV=1 1 164 6.0E-22
sp|Q9FQ19|SCC13_ARATH Sister chromatid cohesion 1 protein 3 OS=Arabidopsis thaliana GN=SYN3 PE=2 SV=2 1 124 4.0E-17
sp|Q9FQ20|SCC12_ARATH Sister chromatid cohesion 1 protein 2 OS=Arabidopsis thaliana GN=SYN2 PE=2 SV=2 1 87 4.0E-15
sp|Q9S7T7|SCC11_ARATH Sister chromatid cohesion 1 protein 1 OS=Arabidopsis thaliana GN=SYN1 PE=2 SV=2 6 114 1.0E-11
sp|Q12158|SCC1_YEAST Sister chromatid cohesion protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MCD1 PE=1 SV=1 7 226 8.0E-11
sp|O95072|REC8_HUMAN Meiotic recombination protein REC8 homolog OS=Homo sapiens GN=REC8 PE=1 SV=1 1 111 4.0E-07
sp|Q6AYJ4|REC8_RAT Meiotic recombination protein REC8 homolog OS=Rattus norvegicus GN=Rec8 PE=1 SV=1 1 111 1.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 29 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1333
MFYSETLLNNNGPLARVWLSANLERKLSKNHVLQSNVTDSVEAIITPNQAPMALRLSSQLLLGVVRIYQRKTRYL
LDDCNEAMMKIKMAFRSSGNNDLAANLQMPNREALLLPDKITPYDNLDLPPPPDASWLLSQVDEVTTAPIGRKGR
ANNNRDINLQEEFDNSQFLQGSNGLDEDALAPMDDLELELDFGLDMEGGPSQSIEVGRDAPAAPWDVEDDVLSEA
DVAPRREPEAVKEDARAHGLGDAAVRIADEEGDIQMGDDDFGFNPGDQSAVPEMTGSADIKRARISESPLSDIDE
AFAREVEAEYSRYNHTDLYEPQEEDVENSLVRRPAQRAKKQKMMMPDSEIALSSSHIKQQQADRHNIIKTAAFLP
RDPLLLALMDMQKSGGFVSSVMMEGRSSAWAPELRGILCLDLMRGISELKRKRDSGIADVDSDQGAVKSPRLELG
DGDDMEFGFGGDALGDQSAAADGTVLEMAAVDEAERGGSASSPIPAFDETTAPVVHPADSGPVSIGTKHAVHILR
DLFGAEAATDEDMRKKTSVVFQNLLPEKRTTKAEATKMFFECLVLATKDAIKVEQGPGLGDAIMVRGKRGLWGDW
AEREAGGEISNQDEPESAAVSAPAVAVEA
Coding >Ophio5|1333
ATGTTCTACTCGGAGACGCTGCTCAACAACAACGGCCCGCTGGCCCGCGTCTGGCTCTCGGCCAACCTCGAGCGC
AAGCTGTCCAAGAACCATGTCCTGCAGTCCAATGTCACCGACAGCGTTGAGGCCATCATCACGCCTAACCAGGCG
CCCATGGCCTTGCGCCTCAGCAGTCAGCTGCTACTGGGTGTCGTCAGGATATACCAGCGGAAGACGCGTTACCTG
CTCGACGACTGCAATGAGGCCATGATGAAGATTAAGATGGCCTTCCGCTCCAGCGGCAATAACGATCTCGCTGCA
AACCTACAAATGCCCAACCGCGAGGCCTTGTTGCTCCCAGATAAGATCACACCCTACGACAACCTCGACCTCCCT
CCGCCTCCTGATGCCTCGTGGCTCCTGTCACAGGTCGACGAGGTGACGACGGCCCCAATAGGCCGGAAGGGACGC
GCCAACAACAACCGAGACATTAACCTGCAAGAAGAGTTCGACAACAGCCAGTTCCTGCAGGGGAGCAACGGGCTG
GATGAGGATGCCCTGGCTCCTATGGACGACCTCGAGCTCGAGCTCGATTTCGGTCTCGACATGGAGGGCGGTCCC
AGCCAAAGCATTGAAGTGGGCCGAGACGCGCCCGCCGCCCCGTGGGATGTAGAAGACGACGTGCTAAGCGAAGCA
GATGTGGCACCGCGCCGCGAACCCGAAGCTGTCAAGGAAGACGCTCGGGCGCACGGCCTCGGCGACGCCGCCGTC
CGCATCGCTGACGAAGAAGGCGACATCCAGATGGGCGACGATGACTTCGGCTTCAACCCCGGCGATCAGTCTGCC
GTACCGGAGATGACGGGCTCGGCCGACATAAAACGCGCACGCATATCCGAGTCCCCGCTATCGGACATTGATGAG
GCCTTTGCCCGGGAGGTCGAGGCCGAGTATTCGCGCTACAACCACACGGACCTGTACGAGCCGCAGGAGGAAGAC
GTCGAGAACTCGCTGGTCCGGCGGCCGGCGCAGCGCGCCAAAAAACAGAAGATGATGATGCCCGACAGCGAGATT
GCCCTGTCGAGCAGCCACATTAAACAGCAGCAGGCCGACAGACACAACATCATTAAGACGGCTGCCTTTTTGCCG
CGGGATCCGCTTCTGCTGGCTCTGATGGACATGCAAAAGTCGGGCGGCTTCGTGTCGTCGGTCATGATGGAGGGG
CGGAGCTCTGCATGGGCTCCCGAGCTAAGAGGAATACTCTGCCTCGACTTGATGCGCGGCATAAGCGAGCTCAAG
CGGAAGCGGGACAGCGGCATCGCCGACGTCGATAGCGACCAAGGTGCCGTCAAGTCGCCGCGACTGGAGCTCGGA
GACGGAGACGACATGGAGTTCGGCTTTGGCGGCGACGCGCTGGGCGACCAGAGCGCGGCGGCGGACGGAACGGTG
CTGGAGATGGCGGCCGTCGACGAGGCCGAGCGCGGCGGGTCGGCGAGCAGCCCGATACCGGCCTTTGACGAAACC
ACAGCGCCCGTGGTGCACCCGGCCGACAGCGGGCCGGTCTCGATCGGCACCAAGCACGCGGTGCACATCCTGCGC
GACCTCTTTGGCGCCGAGGCGGCGACGGACGAGGACATGAGGAAGAAGACGTCGGTCGTATTTCAGAATCTGTTG
CCGGAGAAGCGGACGACCAAGGCGGAGGCGACCAAGATGTTCTTCGAGTGCCTCGTGCTGGCCACCAAGGACGCC
ATCAAGGTTGAGCAGGGCCCCGGGCTGGGCGACGCCATCATGGTCAGGGGCAAGCGAGGCCTCTGGGGCGACTGG
GCCGAGCGCGAGGCCGGCGGGGAGATATCGAACCAGGACGAGCCCGAGTCGGCAGCCGTCAGCGCGCCGGCCGTT
GCCGTGGAGGCG
Transcript >Ophio5|1333
ATGTTCTACTCGGAGACGCTGCTCAACAACAACGGCCCGCTGGCCCGCGTCTGGCTCTCGGCCAACCTCGAGCGC
AAGCTGTCCAAGAACCATGTCCTGCAGTCCAATGTCACCGACAGCGTTGAGGCCATCATCACGCCTAACCAGGCG
CCCATGGCCTTGCGCCTCAGCAGTCAGCTGCTACTGGGTGTCGTCAGGATATACCAGCGGAAGACGCGTTACCTG
CTCGACGACTGCAATGAGGCCATGATGAAGATTAAGATGGCCTTCCGCTCCAGCGGCAATAACGATCTCGCTGCA
AACCTACAAATGCCCAACCGCGAGGCCTTGTTGCTCCCAGATAAGATCACACCCTACGACAACCTCGACCTCCCT
CCGCCTCCTGATGCCTCGTGGCTCCTGTCACAGGTCGACGAGGTGACGACGGCCCCAATAGGCCGGAAGGGACGC
GCCAACAACAACCGAGACATTAACCTGCAAGAAGAGTTCGACAACAGCCAGTTCCTGCAGGGGAGCAACGGGCTG
GATGAGGATGCCCTGGCTCCTATGGACGACCTCGAGCTCGAGCTCGATTTCGGTCTCGACATGGAGGGCGGTCCC
AGCCAAAGCATTGAAGTGGGCCGAGACGCGCCCGCCGCCCCGTGGGATGTAGAAGACGACGTGCTAAGCGAAGCA
GATGTGGCACCGCGCCGCGAACCCGAAGCTGTCAAGGAAGACGCTCGGGCGCACGGCCTCGGCGACGCCGCCGTC
CGCATCGCTGACGAAGAAGGCGACATCCAGATGGGCGACGATGACTTCGGCTTCAACCCCGGCGATCAGTCTGCC
GTACCGGAGATGACGGGCTCGGCCGACATAAAACGCGCACGCATATCCGAGTCCCCGCTATCGGACATTGATGAG
GCCTTTGCCCGGGAGGTCGAGGCCGAGTATTCGCGCTACAACCACACGGACCTGTACGAGCCGCAGGAGGAAGAC
GTCGAGAACTCGCTGGTCCGGCGGCCGGCGCAGCGCGCCAAAAAACAGAAGATGATGATGCCCGACAGCGAGATT
GCCCTGTCGAGCAGCCACATTAAACAGCAGCAGGCCGACAGACACAACATCATTAAGACGGCTGCCTTTTTGCCG
CGGGATCCGCTTCTGCTGGCTCTGATGGACATGCAAAAGTCGGGCGGCTTCGTGTCGTCGGTCATGATGGAGGGG
CGGAGCTCTGCATGGGCTCCCGAGCTAAGAGGAATACTCTGCCTCGACTTGATGCGCGGCATAAGCGAGCTCAAG
CGGAAGCGGGACAGCGGCATCGCCGACGTCGATAGCGACCAAGGTGCCGTCAAGTCGCCGCGACTGGAGCTCGGA
GACGGAGACGACATGGAGTTCGGCTTTGGCGGCGACGCGCTGGGCGACCAGAGCGCGGCGGCGGACGGAACGGTG
CTGGAGATGGCGGCCGTCGACGAGGCCGAGCGCGGCGGGTCGGCGAGCAGCCCGATACCGGCCTTTGACGAAACC
ACAGCGCCCGTGGTGCACCCGGCCGACAGCGGGCCGGTCTCGATCGGCACCAAGCACGCGGTGCACATCCTGCGC
GACCTCTTTGGCGCCGAGGCGGCGACGGACGAGGACATGAGGAAGAAGACGTCGGTCGTATTTCAGAATCTGTTG
CCGGAGAAGCGGACGACCAAGGCGGAGGCGACCAAGATGTTCTTCGAGTGCCTCGTGCTGGCCACCAAGGACGCC
ATCAAGGTTGAGCAGGGCCCCGGGCTGGGCGACGCCATCATGGTCAGGGGCAAGCGAGGCCTCTGGGGCGACTGG
GCCGAGCGCGAGGCCGGCGGGGAGATATCGAACCAGGACGAGCCCGAGTCGGCAGCCGTCAGCGCGCCGGCCGTT
GCCGTGGAGGCGTGA
Gene >Ophio5|1333
ATGTTCTACTCGGAGACGCTGCTCAACAACAACGGCCCGCTGGCCCGCGTCTGGCTCTCGGCCAACCTCGAGCGC
AAGCTGTCCAAGAACCATGTCCTGCAGTCCAATGTCACCGACAGCGTTGAGGCCATCATCACGCCTAACCAGGCG
CCCATGGCCTTGCGCCTCAGCAGTCAGCTGCTACTGGGTGTCGTCAGGATATACCAGCGGAAGACGCGTTACCTG
CTCGACGACTGCAATGAGGCCATGATGAAGATTAAGATGGTTCGTGTCCTTTCCCTTCTCGCTTTCATGCTCTCT
CTCTCTCTCTCTCTCAACATCACTCCTTGTCATTCATCCCCTTCTTTTCCGTCTCTTCCCTACCCGTCCCCCGTC
ATCTCCCTCCTCTCGCGCTCGTCTCCCCTGACCCCTCGGCTCACCATCATTAGGCCTTCCGCTCCAGCGGCAATA
ACGATCTCGCTGCAAACCTACAAATGCCCAACCGCGAGGCCTTGTTGCTCCCAGATAAGATCACACCCTACGACA
ACCTCGACCTCCCTCCGCCTCCTGATGCCTCGTGGCTCCTGTCACAGGTCGACGAGGTGACGACGGCCCCAATAG
GCCGGAAGGGACGCGCCAACAACAACCGAGACATTAACCTGCAAGAAGAGTTCGACAACAGCCAGTTCCTGCAGG
GGAGCAACGGGCTGGATGAGGATGCCCTGGCTCCTATGGACGACCTCGAGCTCGAGCTCGATTTCGGTCTCGACA
TGGAGGGCGGTCCCAGCCAAAGCATTGAAGTGGGCCGAGACGCGCCCGCCGCCCCGTGGGATGTAGAAGACGACG
TGCTAAGCGAAGCAGATGTGGCACCGCGCCGCGAACCCGAAGCTGTCAAGGAAGACGCTCGGGCGCACGGCCTCG
GCGACGCCGCCGTCCGCATCGCTGACGAAGAAGGCGACATCCAGATGGGCGACGATGACTTCGGCTTCAACCCCG
GCGATCAGTCTGCCGTACCGGAGATGACGGGCTCGGCCGACATAAAACGCGCACGCATATCCGAGTCCCCGCTAT
CGGACATTGATGAGGCCTTTGCCCGGGAGGTCGAGGCCGAGTATTCGCGCTACAACCACACGGACCTGTACGAGC
CGCAGGAGGAAGACGTCGAGAACTCGCTGGTCCGGCGGCCGGCGCAGCGCGCCAAAAAACAGAAGATGATGATGC
CCGACAGCGAGATTGCCCTGTCGAGCAGCCACATTAAACAGCAGCAGGCCGACAGACACAACATCATTAAGACGG
CTGCCTTTTTGCCGCGGGATCCGCTTCTGCTGGCTCTGATGGACATGCAAAAGTCGGGCGGCTTCGTGTCGTCGG
TCATGATGGAGGGGCGGAGCTCTGCATGGGCTCCCGAGCTAAGAGGAATACTCTGCCTCGACTTGATGCGCGGCA
TAAGCGAGCTCAAGCGGAAGCGGGACAGCGGCATCGCCGACGTCGATAGCGACCAAGGTGCCGTCAAGTCGCCGC
GACTGGAGCTCGGAGACGGAGACGACATGGAGTTCGGCTTTGGCGGCGACGCGCTGGGCGACCAGAGCGCGGCGG
CGGACGGAACGGTGCTGGAGATGGCGGCCGTCGACGAGGCCGAGCGCGGCGGGTCGGCGAGCAGCCCGATACCGG
CCTTTGACGAAACCACAGCGCCCGTGGTGCACCCGGCCGACAGCGGGCCGGTCTCGATCGGCACCAAGCACGCGG
TGCACATCCTGCGCGACCTCTTTGGCGCCGAGGCGGCGACGGACGAGGACATGAGGAAGAAGACGTCGGTCGTAT
TTCAGAATCTGTTGCCGGAGAAGCGGACGACCAAGGCGGAGGCGACCAAGATGTTCTTCGAGTGCCTCGTGCTGG
CCACCAAGGACGCCATCAAGGTTGAGCAGGGCCCCGGGCTGGGCGACGCCATCATGGTCAGGGGCAAGCGAGGCC
TCTGGGGCGACTGGGCCGAGCGCGAGGCCGGCGGGGAGATATCGAACCAGGACGAGCCCGAGTCGGCAGCCGTCA
GCGCGCCGGCCGTTGCCGTGGAGGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail