Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1332
Gene name
Locationscaffold_144:5901..6333
Strand-
Gene length (bp)432
Transcript length (bp)348
Coding sequence length (bp)345
Protein length (aa) 115

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02970 TBCA Tubulin binding cofactor A 1.8E-24 2 104

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P48606|TBCA_YEAST Tubulin-specific chaperone A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RBL2 PE=1 SV=1 3 101 5.0E-07

GO

GO Term Description Terminal node
GO:0007023 post-chaperonin tubulin folding pathway Yes
GO:0007021 tubulin complex assembly Yes
GO:0048487 beta-tubulin binding Yes
GO:0043933 protein-containing complex organization No
GO:0009987 cellular process No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No
GO:0022607 cellular component assembly No
GO:0071840 cellular component organization or biogenesis No
GO:0006457 protein folding No
GO:0005515 protein binding No
GO:0016043 cellular component organization No
GO:0003674 molecular_function No
GO:0008150 biological_process No
GO:0065003 protein-containing complex assembly No
GO:0015631 tubulin binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1332
MPAPSPLSISTGSVQRLLKEEASYHTELAEQQARAKALATTKGEDEDGNAAFLLKQQRAVVEQTRAVFAPLRLRI
DEAVAKLEEQLAAAEGEDSQDVASARHVLELAGKAKAERG
Coding >Ophio5|1332
ATGCCAGCTCCGTCGCCGCTCTCCATCAGCACCGGCTCGGTGCAGCGGCTGCTGAAGGAGGAGGCCTCGTATCAC
ACCGAGCTGGCGGAGCAGCAGGCGCGGGCGAAGGCTCTGGCGACGACCAAGGGGGAAGATGAGGATGGCAACGCG
GCGTTTTTGCTGAAGCAACAGCGCGCCGTCGTCGAGCAGACGCGGGCTGTCTTCGCGCCGCTGCGGCTACGTATC
GACGAGGCTGTCGCCAAGCTAGAGGAGCAGCTTGCTGCGGCCGAGGGCGAGGATTCTCAGGACGTGGCGAGTGCG
AGGCATGTGTTGGAACTGGCTGGCAAGGCCAAGGCGGAGCGAGGT
Transcript >Ophio5|1332
ATGCCAGCTCCGTCGCCGCTCTCCATCAGCACCGGCTCGGTGCAGCGGCTGCTGAAGGAGGAGGCCTCGTATCAC
ACCGAGCTGGCGGAGCAGCAGGCGCGGGCGAAGGCTCTGGCGACGACCAAGGGGGAAGATGAGGATGGCAACGCG
GCGTTTTTGCTGAAGCAACAGCGCGCCGTCGTCGAGCAGACGCGGGCTGTCTTCGCGCCGCTGCGGCTACGTATC
GACGAGGCTGTCGCCAAGCTAGAGGAGCAGCTTGCTGCGGCCGAGGGCGAGGATTCTCAGGACGTGGCGAGTGCG
AGGCATGTGTTGGAACTGGCTGGCAAGGCCAAGGCGGAGCGAGGTTGA
Gene >Ophio5|1332
ATGCCAGCTCCGTCGCCGCTCTCCATCAGCACCGGCTCGGTGCAGCGGCTGCTGAAGGAGGAGGCCTCGTATCAC
ACCGAGCTGGCGGAGCAGCAGGCGCGGGCGAAGGCTCTGGCGACGACCAAGGGGGAAGATGAGGATGGCAACGCG
GCGTTTTTGCTGAAGCAACAGGTGCGTCCTTTTTTTTACCCAGATTCCTTTTTAGTTTCCAAGAACTGACGTACC
TTTGTTCCTTTCCCGCCCCCGTTCCTGCAGCGCGCCGTCGTCGAGCAGACGCGGGCTGTCTTCGCGCCGCTGCGG
CTACGTATCGACGAGGCTGTCGCCAAGCTAGAGGAGCAGCTTGCTGCGGCCGAGGGCGAGGATTCTCAGGACGTG
GCGAGTGCGAGGCATGTGTTGGAACTGGCTGGCAAGGCCAAGGCGGAGCGAGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail