Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1322
Gene name
Locationscaffold_143:33210..34451
Strand-
Gene length (bp)1241
Transcript length (bp)1179
Coding sequence length (bp)1176
Protein length (aa) 392

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HVS2|GNT1_GIBZE Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GNT1 PE=3 SV=1 94 355 6.0E-119
sp|Q4WBL2|GNT1_ASPFU Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gnt1 PE=3 SV=1 92 374 9.0E-97
sp|Q6BUZ2|GNT1_DEBHA Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GNT1 PE=3 SV=2 35 335 5.0E-27
sp|Q59ZI3|GNT1_CANAL Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GNT1 PE=3 SV=1 88 372 1.0E-25
sp|Q6FQ15|GNT1_CANGA Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GNT1 PE=3 SV=1 41 307 5.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4HVS2|GNT1_GIBZE Glucose N-acetyltransferase 1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=GNT1 PE=3 SV=1 94 355 6.0E-119
sp|Q4WBL2|GNT1_ASPFU Glucose N-acetyltransferase 1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=gnt1 PE=3 SV=1 92 374 9.0E-97
sp|Q6BUZ2|GNT1_DEBHA Glucose N-acetyltransferase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=GNT1 PE=3 SV=2 35 335 5.0E-27
sp|Q59ZI3|GNT1_CANAL Glucose N-acetyltransferase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GNT1 PE=3 SV=1 88 372 1.0E-25
sp|Q6FQ15|GNT1_CANGA Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GNT1 PE=3 SV=1 41 307 5.0E-23
sp|Q6CT96|GNT1B_KLULA Glucose N-acetyltransferase 1-B OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GNT1-B PE=3 SV=1 87 228 3.0E-20
sp|Q12096|GNT1_YEAST Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNT1 PE=1 SV=1 85 228 4.0E-20
sp|Q9Y761|GNT1A_KLULA Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GNT1-A PE=3 SV=1 85 234 2.0E-18
sp|Q9Y761|GNT1A_KLULA Glucose N-acetyltransferase 1-A OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GNT1-A PE=3 SV=1 236 363 4.0E-08
sp|Q8GWB7|GUX6_ARATH Inositol phosphorylceramide glucuronosyltransferase 1 OS=Arabidopsis thaliana GN=IPUT1 PE=1 SV=1 81 275 8.0E-08
sp|Q12096|GNT1_YEAST Glucose N-acetyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GNT1 PE=1 SV=1 232 377 1.0E-07
sp|Q5UNW1|YR707_MIMIV Uncharacterized protein R707 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R707 PE=4 SV=1 95 256 2.0E-07
sp|Q9FZ37|GUX4_ARATH Putative UDP-glucuronate:xylan alpha-glucuronosyltransferase 4 OS=Arabidopsis thaliana GN=GUX4 PE=3 SV=1 71 273 3.0E-07
sp|Q6FQ15|GNT1_CANGA Glucose N-acetyltransferase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=GNT1 PE=3 SV=1 232 374 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1322
MATNARVPTWLQHVFHTLRRPKDAALHSSGRPTLSGILSSRWLRLVASAVTAGLILLLLARNYGTLPSVSAWPRP
KADGLLRPLDMTRAPGIDWSQFAYTQYVTNSEYLCNSIMLFEVLHRLGSKADRVIMYPSHMVDREAREADTDDGR
LLIKARDDYRVRLVPISVQHRNSADSTWADSFTKLLAFNQTQYSRVLSLDSDAVIMQTMDELFLLPPCPVAMPRA
YWLYPDKKMLSSQLMLVQPSQREFQRVMEKINSAKSNDYDMEIVNDLYQDSAMILPHRPYDLLTAEFRTDNHVNY
LGSDREAWDPVAIYNEAKFVHFSDWPVPKPWISMSEQVRAEKQPKCHTKDGVEQCVERDFWNGFYDDFRRRREVS
LLAPPPPPPPLFFSPPE
Coding >Ophio5|1322
ATGGCTACCAACGCTCGCGTCCCGACATGGCTCCAGCACGTCTTCCACACACTACGACGGCCCAAGGATGCCGCT
CTGCATTCCAGCGGCCGTCCCACTCTCTCCGGCATATTATCCTCCCGGTGGCTTCGTCTCGTCGCCAGCGCTGTC
ACCGCCGGCCTCATCCTCCTGCTGCTGGCCAGAAATTATGGCACCCTGCCGAGTGTATCCGCTTGGCCTCGACCG
AAAGCCGATGGCCTACTTCGGCCTCTGGACATGACGCGTGCCCCTGGCATCGACTGGTCGCAATTCGCATACACG
CAATACGTTACCAACAGCGAGTACTTGTGTAACTCGATCATGCTTTTCGAGGTCCTACATCGACTCGGCAGCAAG
GCCGATCGCGTCATCATGTACCCGTCACATATGGTCGACCGGGAAGCGCGAGAGGCCGATACGGATGACGGGCGA
TTGTTGATCAAGGCTCGAGATGACTACCGCGTTCGACTGGTGCCTATCTCGGTTCAGCATAGGAATAGTGCCGAT
AGCACATGGGCCGACTCCTTTACCAAGCTGCTCGCCTTCAACCAAACCCAATACAGCCGGGTCTTGTCTCTCGAT
TCCGATGCCGTCATAATGCAGACCATGGATGAACTTTTCCTCCTACCGCCATGCCCCGTCGCCATGCCCCGAGCA
TACTGGCTCTACCCCGACAAGAAAATGCTTTCTTCCCAGCTCATGCTGGTGCAGCCGAGCCAGAGGGAATTCCAA
CGAGTCATGGAAAAGATCAACAGCGCCAAGAGCAACGACTACGACATGGAGATTGTCAACGACTTGTATCAGGAC
AGCGCCATGATCCTCCCCCATCGTCCCTACGACCTTTTGACCGCCGAGTTCCGCACAGACAACCACGTCAACTAC
CTCGGCTCCGATCGTGAGGCCTGGGATCCGGTTGCCATCTACAACGAGGCCAAGTTTGTCCACTTTTCCGACTGG
CCCGTCCCCAAGCCGTGGATATCCATGTCTGAGCAGGTGCGAGCGGAGAAGCAACCGAAATGCCACACCAAAGAC
GGCGTGGAGCAGTGCGTCGAGAGAGATTTTTGGAATGGCTTCTATGATGACTTTCGACGACGTCGGGAGGTCAGT
CTTTTGGCCCCCCCCCCCCCCCCCCCCCCCCTTTTTTTTTCCCCCCCTGAG
Transcript >Ophio5|1322
ATGGCTACCAACGCTCGCGTCCCGACATGGCTCCAGCACGTCTTCCACACACTACGACGGCCCAAGGATGCCGCT
CTGCATTCCAGCGGCCGTCCCACTCTCTCCGGCATATTATCCTCCCGGTGGCTTCGTCTCGTCGCCAGCGCTGTC
ACCGCCGGCCTCATCCTCCTGCTGCTGGCCAGAAATTATGGCACCCTGCCGAGTGTATCCGCTTGGCCTCGACCG
AAAGCCGATGGCCTACTTCGGCCTCTGGACATGACGCGTGCCCCTGGCATCGACTGGTCGCAATTCGCATACACG
CAATACGTTACCAACAGCGAGTACTTGTGTAACTCGATCATGCTTTTCGAGGTCCTACATCGACTCGGCAGCAAG
GCCGATCGCGTCATCATGTACCCGTCACATATGGTCGACCGGGAAGCGCGAGAGGCCGATACGGATGACGGGCGA
TTGTTGATCAAGGCTCGAGATGACTACCGCGTTCGACTGGTGCCTATCTCGGTTCAGCATAGGAATAGTGCCGAT
AGCACATGGGCCGACTCCTTTACCAAGCTGCTCGCCTTCAACCAAACCCAATACAGCCGGGTCTTGTCTCTCGAT
TCCGATGCCGTCATAATGCAGACCATGGATGAACTTTTCCTCCTACCGCCATGCCCCGTCGCCATGCCCCGAGCA
TACTGGCTCTACCCCGACAAGAAAATGCTTTCTTCCCAGCTCATGCTGGTGCAGCCGAGCCAGAGGGAATTCCAA
CGAGTCATGGAAAAGATCAACAGCGCCAAGAGCAACGACTACGACATGGAGATTGTCAACGACTTGTATCAGGAC
AGCGCCATGATCCTCCCCCATCGTCCCTACGACCTTTTGACCGCCGAGTTCCGCACAGACAACCACGTCAACTAC
CTCGGCTCCGATCGTGAGGCCTGGGATCCGGTTGCCATCTACAACGAGGCCAAGTTTGTCCACTTTTCCGACTGG
CCCGTCCCCAAGCCGTGGATATCCATGTCTGAGCAGGTGCGAGCGGAGAAGCAACCGAAATGCCACACCAAAGAC
GGCGTGGAGCAGTGCGTCGAGAGAGATTTTTGGAATGGCTTCTATGATGACTTTCGACGACGTCGGGAGGTCAGT
CTTTTGGCCCCCCCCCCCCCCCCCCCCCCCCTTTTTTTTTCCCCCCCTGAGTAG
Gene >Ophio5|1322
ATGGCTACCAACGCTCGCGTCCCGACATGGCTCCAGCACGTCTTCCACACACTACGACGGCCCAAGGATGCCGCT
CTGCATTCCAGCGGCCGTCCCACTCTCTCCGGCATATTATCCTCCCGGTGGCTTCGTCTCGTCGCCAGCGCTGTC
ACCGCCGGCCTCATCCTCCTGCTGCTGGCCAGAAATTATGGCACCCTGCCGAGTGTATCCGCTTGGCCTCGACCG
AAAGCCGATGGCCTACTTCGGCCTCTGGACATGACGCGTGCCCCTGGCATCGACTGGTCGCAATTCGCATACACG
CAATACGTTACCAACAGCGAGTACTTGTGTAACTCGATCATGCTTTTCGAGGTCCTACATCGACTCGGCAGCAAG
GCCGATCGCGTCATCATGTACCCGTCACATATGGTCGACCGGGAAGCGCGAGAGGCCGATACGGATGACGGGCGA
TTGTTGATCAAGGCTCGAGATGACTACCGCGTTCGACTGGTGCCTATCTCGGTTCAGCATAGGAATAGTGCCGAT
AGTAAGAAGTCGTCTTCTTTTTATCCCCGTTGCTTCGCCACTGACGACGGCTTCTTGTTTTAGGCACATGGGCCG
ACTCCTTTACCAAGCTGCTCGCCTTCAACCAAACCCAATACAGCCGGGTCTTGTCTCTCGATTCCGATGCCGTCA
TAATGCAGACCATGGATGAACTTTTCCTCCTACCGCCATGCCCCGTCGCCATGCCCCGAGCATACTGGCTCTACC
CCGACAAGAAAATGCTTTCTTCCCAGCTCATGCTGGTGCAGCCGAGCCAGAGGGAATTCCAACGAGTCATGGAAA
AGATCAACAGCGCCAAGAGCAACGACTACGACATGGAGATTGTCAACGACTTGTATCAGGACAGCGCCATGATCC
TCCCCCATCGTCCCTACGACCTTTTGACCGCCGAGTTCCGCACAGACAACCACGTCAACTACCTCGGCTCCGATC
GTGAGGCCTGGGATCCGGTTGCCATCTACAACGAGGCCAAGTTTGTCCACTTTTCCGACTGGCCCGTCCCCAAGC
CGTGGATATCCATGTCTGAGCAGGTGCGAGCGGAGAAGCAACCGAAATGCCACACCAAAGACGGCGTGGAGCAGT
GCGTCGAGAGAGATTTTTGGAATGGCTTCTATGATGACTTTCGACGACGTCGGGAGGTCAGTCTTTTGGCCCCCC
CCCCCCCCCCCCCCCCCCTTTTTTTTTCCCCCCCTGAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail