Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1307
Gene name
Locationscaffold_1423:150..1560
Strand+
Gene length (bp)1410
Transcript length (bp)1134
Coding sequence length (bp)1131
Protein length (aa) 377

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08449 UAA UAA transporter family 1.3E-91 28 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74750|YEA4_SCHPO UDP-N-acetylglucosamine transporter yea4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yea4 PE=3 SV=1 26 342 5.0E-61
sp|P40004|YEA4_YEAST UDP-N-acetylglucosamine transporter YEA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA4 PE=1 SV=1 28 343 5.0E-60
sp|Q8CIA5|S35B4_MOUSE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35b4 PE=2 SV=2 26 356 6.0E-58
sp|Q95KB4|S35B4_MACFA UDP-xylose and UDP-N-acetylglucosamine transporter OS=Macaca fascicularis GN=SLC35B4 PE=2 SV=1 26 334 1.0E-57
sp|Q5R8M3|S35B4_PONAB UDP-xylose and UDP-N-acetylglucosamine transporter OS=Pongo abelii GN=SLC35B4 PE=2 SV=1 26 346 3.0E-57
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74750|YEA4_SCHPO UDP-N-acetylglucosamine transporter yea4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=yea4 PE=3 SV=1 26 342 5.0E-61
sp|P40004|YEA4_YEAST UDP-N-acetylglucosamine transporter YEA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YEA4 PE=1 SV=1 28 343 5.0E-60
sp|Q8CIA5|S35B4_MOUSE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Mus musculus GN=Slc35b4 PE=2 SV=2 26 356 6.0E-58
sp|Q95KB4|S35B4_MACFA UDP-xylose and UDP-N-acetylglucosamine transporter OS=Macaca fascicularis GN=SLC35B4 PE=2 SV=1 26 334 1.0E-57
sp|Q5R8M3|S35B4_PONAB UDP-xylose and UDP-N-acetylglucosamine transporter OS=Pongo abelii GN=SLC35B4 PE=2 SV=1 26 346 3.0E-57
sp|Q969S0|S35B4_HUMAN UDP-xylose and UDP-N-acetylglucosamine transporter OS=Homo sapiens GN=SLC35B4 PE=1 SV=1 26 346 7.0E-57
sp|Q7ZW46|S35B4_DANRE UDP-xylose and UDP-N-acetylglucosamine transporter OS=Danio rerio GN=slc35b4 PE=2 SV=1 28 349 8.0E-57
sp|Q9W429|S35B4_DROME UDP-xylose and UDP-N-acetylglucosamine transporter OS=Drosophila melanogaster GN=Efr PE=2 SV=1 27 377 4.0E-56
sp|Q00974|YEA4_KLULA UDP-N-acetylglucosamine transporter YEA4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=YEA4 PE=3 SV=1 29 337 2.0E-55
sp|Q869W7|S35B4_DICDI UDP-N-acetylglucosamine transporter slc35b4 OS=Dictyostelium discoideum GN=slc35b4 PE=3 SV=2 23 358 3.0E-45
[Show less]

GO

GO Term Description Terminal node
GO:0055085 transmembrane transport Yes
GO:0009987 cellular process No
GO:0051234 establishment of localization No
GO:0006810 transport No
GO:0051179 localization No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 53 72 19
3 92 111 19
4 121 138 17
5 145 162 17
6 177 199 22
7 279 298 19
8 318 337 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1307
MVTRTIPANNTHSAVFPFVQSLLLEAAALGLIFGGCCSNVYALEAIISFERSSGMLLTFMQFLFVASTSYIAQFD
RTRPPLYIAPAKIPLRHWLVNITLFFSINVLNNHAFSYNISVPLHIILRSGGSITTMLAGYLYGKRYSRVQALAV
TLLSFGIALAAWSNDEVKTNQKDSIRPTSTVGLGVLFVAQLLSAALGLHTETIYQQHGPQWRENLFYSHLLSLPL
FFPFMPSMSRVLSLMATTETLELKMPPFAAGVGMPVQLAYLTTNVMTQYACIRGVNLLAANASALTVTVVLSVRK
LVSLIISIWLFGNKLPNGTLVGAVIVFSSGLLYSVGSGSKPRKITRTEELLNEDQDANKLDHARQGESSVPVNKK
QD
Coding >Ophio5|1307
ATGGTCACCCGCACAATTCCCGCGAACAATACCCATTCTGCCGTGTTCCCTTTCGTCCAATCTTTACTATTGGAA
GCAGCTGCCTTGGGCCTTATTTTCGGAGGTTGCTGCTCAAATGTCTACGCGCTGGAAGCTATAATCAGCTTCGAG
CGGTCGAGCGGGATGCTTCTGACATTCATGCAATTTCTCTTCGTGGCCAGCACGAGTTACATTGCGCAGTTTGAC
AGGACCAGACCGCCTCTCTATATCGCGCCCGCCAAAATTCCGTTACGACATTGGCTGGTCAACATCACACTTTTT
TTCAGCATTAATGTCCTCAACAACCACGCTTTCAGCTATAACATATCCGTCCCATTGCACATCATTTTACGGTCG
GGCGGAAGCATCACCACGATGCTGGCAGGCTATCTATATGGGAAAAGATACTCTCGTGTTCAGGCTCTGGCTGTC
ACTCTACTGAGTTTCGGAATTGCGTTGGCCGCCTGGTCTAATGATGAGGTAAAGACCAACCAGAAAGATTCCATA
CGACCGACGTCCACCGTCGGTCTCGGTGTCCTGTTTGTGGCGCAGTTGCTCTCAGCTGCGTTGGGCCTCCACACG
GAGACGATTTATCAACAACATGGCCCGCAGTGGCGAGAGAATCTTTTCTACTCGCACCTCCTTTCGTTGCCCCTC
TTCTTCCCCTTTATGCCATCGATGTCTCGGGTTTTGAGTCTGATGGCTACGACTGAGACGCTTGAACTCAAGATG
CCGCCTTTTGCTGCGGGCGTGGGAATGCCTGTCCAGCTAGCATATTTGACTACGAACGTGATGACTCAATACGCT
TGCATCCGCGGCGTGAATCTTCTCGCTGCCAACGCCTCAGCGCTCACAGTTACTGTGGTTCTAAGTGTCCGGAAG
CTTGTCAGCTTGATTATCAGCATCTGGCTTTTCGGCAACAAGTTACCCAACGGTACCCTAGTCGGCGCCGTCATA
GTCTTCAGCTCCGGGTTACTCTACTCGGTGGGATCCGGGTCAAAACCGAGGAAAATTACTAGAACTGAGGAACTC
TTGAACGAGGATCAGGATGCTAATAAGCTCGACCACGCACGTCAAGGAGAATCGTCCGTACCAGTCAATAAAAAA
CAAGAC
Transcript >Ophio5|1307
ATGGTCACCCGCACAATTCCCGCGAACAATACCCATTCTGCCGTGTTCCCTTTCGTCCAATCTTTACTATTGGAA
GCAGCTGCCTTGGGCCTTATTTTCGGAGGTTGCTGCTCAAATGTCTACGCGCTGGAAGCTATAATCAGCTTCGAG
CGGTCGAGCGGGATGCTTCTGACATTCATGCAATTTCTCTTCGTGGCCAGCACGAGTTACATTGCGCAGTTTGAC
AGGACCAGACCGCCTCTCTATATCGCGCCCGCCAAAATTCCGTTACGACATTGGCTGGTCAACATCACACTTTTT
TTCAGCATTAATGTCCTCAACAACCACGCTTTCAGCTATAACATATCCGTCCCATTGCACATCATTTTACGGTCG
GGCGGAAGCATCACCACGATGCTGGCAGGCTATCTATATGGGAAAAGATACTCTCGTGTTCAGGCTCTGGCTGTC
ACTCTACTGAGTTTCGGAATTGCGTTGGCCGCCTGGTCTAATGATGAGGTAAAGACCAACCAGAAAGATTCCATA
CGACCGACGTCCACCGTCGGTCTCGGTGTCCTGTTTGTGGCGCAGTTGCTCTCAGCTGCGTTGGGCCTCCACACG
GAGACGATTTATCAACAACATGGCCCGCAGTGGCGAGAGAATCTTTTCTACTCGCACCTCCTTTCGTTGCCCCTC
TTCTTCCCCTTTATGCCATCGATGTCTCGGGTTTTGAGTCTGATGGCTACGACTGAGACGCTTGAACTCAAGATG
CCGCCTTTTGCTGCGGGCGTGGGAATGCCTGTCCAGCTAGCATATTTGACTACGAACGTGATGACTCAATACGCT
TGCATCCGCGGCGTGAATCTTCTCGCTGCCAACGCCTCAGCGCTCACAGTTACTGTGGTTCTAAGTGTCCGGAAG
CTTGTCAGCTTGATTATCAGCATCTGGCTTTTCGGCAACAAGTTACCCAACGGTACCCTAGTCGGCGCCGTCATA
GTCTTCAGCTCCGGGTTACTCTACTCGGTGGGATCCGGGTCAAAACCGAGGAAAATTACTAGAACTGAGGAACTC
TTGAACGAGGATCAGGATGCTAATAAGCTCGACCACGCACGTCAAGGAGAATCGTCCGTACCAGTCAATAAAAAA
CAAGACTAA
Gene >Ophio5|1307
ATGGTCACCCGCACAATTCCCGCGAACAATACCCATTCTGCCGTGTTCCCTTTCGTCCAATCTTTACTATTGGAA
GCAGCTGCCTTGGGCCTTATTTTCGGAGGTTGCTGCTCAAATGTAAGGTTTTCAGCGCACCCTTTTACCACAACA
CCCTATTATACGGAGTCTGGCTGACGATAGACTTAGGTCTACGCGCTGGAAGCTATAATCAGGTCAGCTGATGGT
GTTACTTCATTCTACCTAAGTACATCGGAATTGACCCATGCGAGGGCTCTTGGTGCGAAGCTTCGAGCGGTCGAG
CGGTAAACGACCCAATACGCCTCACTGACGACTTGCTGACTTGCACCAGGGATGCTTCTGACATTCATGCAATTT
CTCTTCGTGGCCAGCACGAGTTACATTGCGCAGTTTGACAGGACCAGACCGCCTCTCTATATCGCGCCCGCCAAA
ATTCCGTTACGACATTGGCTGGTCAACATCACACTTTTTTTCAGCATTAATGTCCTCAACAACCACGCTTTCAGC
TATAACATATCCGTCCCATTGCACATCATTTTACGGTCGGGCGGAAGCATCACCACGATGCTGGCAGGCTATCTA
TATGGGAAAAGATACTCTCGTGTTCAGGCTCTGGCTGTCACTCTACTGAGTTTCGGAATTGCGTTGGCCGCCTGG
TCTAATGATGAGGTAAAGGCTAGTACAAGACTGGATATGAGGCTTCCCAACGCCGACATTCTCAAAGATATTCCG
AATGGGTTGTACTGACAAATATTGATGCAGACCAACCAGAAAGATTCCATACGACCGACGTCCACCGTCGGTCTC
GGTGTCCTGTTTGTGGCGCAGTTGCTCTCAGCTGCGTTGGGCCTCCACACGGAGACGATTTATCAACAACATGGC
CCGCAGTGGCGAGAGAATCTTTTCTACTCGCACCTCCTTTCGTTGCCCCTCTTCTTCCCCTTTATGCCATCGATG
TCTCGGGTTTTGAGTCTGATGGCTACGACTGAGACGCTTGAACTCAAGATGCCGCCTTTTGCTGCGGGCGTGGGA
ATGCCTGTCCAGCTAGCATATTTGACTACGAACGTGATGACTCAATACGCTTGCATCCGCGGCGTGAATCTTCTC
GCTGCCAACGCCTCAGCGCTCACAGTTACTGTGGTTCTAAGTGTCCGGAAGCTTGTCAGCTTGATTATCAGCATC
TGGCTTTTCGGCAACAAGTTACCCAACGGTACCCTAGTCGGCGCCGTCATAGTCTTCAGCTCCGGGTTACTCTAC
TCGGTGGGATCCGGGTCAAAACCGAGGAAAATTACTAGAACTGAGGAACTCTTGAACGAGGATCAGGATGCTAAT
AAGCTCGACCACGCACGTCAAGGAGAATCGTCCGTACCAGTCAATAAAAAACAAGACTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail