Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1304
Gene name
Locationscaffold_142:36905..37548
Strand+
Gene length (bp)643
Transcript length (bp)372
Coding sequence length (bp)369
Protein length (aa) 123

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular Signal peptide 0.0805 0.0546 0.9731 0.0601 0.0747 0.0153 0.0649 0.0719 0.054 0.0037

SignalP

SignalP signal predicted Location Score
Yes 1 - 21 0.715218

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup15539
Change Orthofinder run
Species Protein ID
Ophiocordyceps kimflemingae Ophio5|1304 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1304
MNLSIIAQYSLMGVAAAGCLANKTDAADAKIKGCTRHGVGLPRGESGMCPSSGEGCEAFCADLYNEHVRNGGSGE
VVGGRSCYYPSDFKGKCKITRPQSGTGGRVTCREGNRAGHSFDCVRGK
Coding >Ophio5|1304
ATGAACCTCTCAATCATCGCTCAGTATTCCTTGATGGGAGTTGCTGCTGCGGGCTGCCTTGCCAACAAGACCGAC
GCTGCCGATGCAAAGATCAAAGGATGCACTCGTCACGGAGTCGGACTACCTCGAGGAGAAAGTGGAATGTGTCCT
TCCAGCGGAGAGGGTTGTGAGGCTTTTTGTGCAGATTTGTACAATGAACATGTTCGAAACGGTGGAAGCGGTGAA
GTGGTTGGAGGACGATCTTGTTACTATCCAAGTGATTTTAAAGGAAAGTGCAAGATCACACGACCACAATCAGGA
ACAGGCGGCCGAGTTACATGTCGAGAAGGAAATCGTGCAGGGCATTCATTTGACTGTGTTAGAGGCAAA
Transcript >Ophio5|1304
ATGAACCTCTCAATCATCGCTCAGTATTCCTTGATGGGAGTTGCTGCTGCGGGCTGCCTTGCCAACAAGACCGAC
GCTGCCGATGCAAAGATCAAAGGATGCACTCGTCACGGAGTCGGACTACCTCGAGGAGAAAGTGGAATGTGTCCT
TCCAGCGGAGAGGGTTGTGAGGCTTTTTGTGCAGATTTGTACAATGAACATGTTCGAAACGGTGGAAGCGGTGAA
GTGGTTGGAGGACGATCTTGTTACTATCCAAGTGATTTTAAAGGAAAGTGCAAGATCACACGACCACAATCAGGA
ACAGGCGGCCGAGTTACATGTCGAGAAGGAAATCGTGCAGGGCATTCATTTGACTGTGTTAGAGGCAAATAA
Gene >Ophio5|1304
ATGAACCTCTCAATCATCGCTCAGTATTCCTTGATGGGAGTTGCTGCTGCGGGCTGCCTTGCCAACAAGACCGAC
GCTGCCGATGCAAAGATCAAAGGATGCACTCGTCACGGAGTCGGACTACCTCGAGGAGAAAGTGGAATGTGTCCT
TCCAGCGGAGAGGGTTGTGAGGCTTTTTGTGCAGATTTGTACAATGAACATGTTCGAAACGGTGGAAGCGGTGAA
GTGGTTGGAGGACGATCTTGTGTAAGTGACTCGTACCGCAACAGCTGAGCCTACCAACAATACGTGCTGACGCGT
GGGGAGCGACATCAGTACTATCCAAGTGATTTTAAAGGAGTAAGCGGCTCATAGGCACCAGGTATGAGAAGGAAC
TCACCTAACCTCTCGGCAGAAGTGCAAGATCACACGACCACAATCAGGAACAGGCGGCCGAGTTACAGTGAGTAC
TTGATTGTTGTCTTATAGCCCGAGTGTGGGCGGATCGCTAACTCCATGAGCGATTATAGTGTCGAGAAGGAAATC
GTGCAGGGCATTCATTTGTGAGTGGTTTCTTAATCTCTAATTCCTTTACCTATCACGTGGTACCCTGAGAACAGG
CTATTAAGACGGACTGCTTCAGGACTGTGTTAGAGGCAAATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail