Fungal Genomics

at Utrecht University

General Properties

Protein IDOphio5|1301
Gene name
Locationscaffold_142:25972..29602
Strand-
Gene length (bp)3630
Transcript length (bp)3630
Coding sequence length (bp)3627
Protein length (aa) 1209

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum 0.2737 0.214 0.0478 0.2197 0.18 0.2483 0.5538 0.4003 0.2584 0.0042

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 419 441 22
2 458 480 22
3 669 691 22
4 712 734 22
5 964 986 22
6 1007 1029 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Expression analysis during behavioral modification. Published in De Bekker et al., 2017.

Click here for more information

Orthologs

Orthofinder run ID4
Orthogroup495
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|03855
Ophiocordyceps camponoti-rufipedis Ophun1|1343
Ophiocordyceps camponoti-rufipedis Ophun1|3105
Ophiocordyceps kimflemingae Ophio5|1301 (this protein)
Ophiocordyceps kimflemingae Ophio5|7906
Ophiocordyceps subramaniannii Hirsu2|1143
Ophiocordyceps subramaniannii Hirsu2|5577
Ophiocordyceps subramaniannii Hirsu2|8061

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophio5|1301
MDEEDEKHSATTLAVTLDWFSSSSSGGGHDSHAQMEKQDDYLDDDGYLRVMGATKDIIHCDTRDVVPEQVEEAIM
TAGEAPDSPIHGRIAAVLAFAIQHETRGEAVAVVLVPSPDVLRVDLRTLHDALRASPLDKGRWPQAIIYMDRLPL
RRGRPLRTRLRIRLGLPRLSDQTPYAARHWEATCPAPDTSLMRPIEVLRCRVDVDAITTTLASVAPSHFMVHVEE
SLEASGYDVFLAPESPTAAGLLPPGGAEHFRRLMNASLIAEGHAGLPGNLYILDEPLPVDECGAPDRARLAEMQT
ELRKDRLPTPVRHVEERVGRAFAEALDWPHSHASSIDKEAGFYRLGGDASRAQRLLASLRVEFNLPLPANLLSPP
RTGSVEAVAALIEARMRDEQAAPRGHGSTETYSSRRTGLLLLQLLPIVFLYPLYVSLGATLQLYVLSKTRFWHNV
ESLGGRLFNLILSLIASWAALEIIFPWVGIAAKWLIIGRYREGVYPMWGSYHTRWWMVQKIVMVCGTGFFDINDH
ARNVYYRLMGARIGHDVRITDVFLGEWDLLDIRDGARLSRCHCRPFAAEKNSSMYLNRIVIGERSSIGLKSVIAP
GTEVLPDTRLGANSSSWEQADSWSAAASSSPHHDRAGGPDGTWPTAGPSAVPIPEPHWLLTLSLTVPIYLIGWLI
SMLPWLLTLVGMLYEPPRHSTIPIRLILDWYQSSPGVAYNYLSVGSSVAISPMLFFLFAICVRAIFRLIVGDPPS
SPSEIRNSVDAWRVALIRTLFPESQMLELNDMIGHHNEARSAVLRLLGARVGQRVCWPTVGPIVRDYHLIDIGDD
VSFGDNCFLQTYDEGDSGVISIGNGAVISDHVCVMPGVSVGERTTLGFGTLTRRGRHYESGKAFIGARAGDAARS
HSIGGVLWPVPDGSGRLLQSQSLVTLVPSNTSSAGNSSILENSPYNRAVYLKDAPYRVLSPTTTLIFSFSMTLFT
TFYWNVAALSSMKVASRIFVRYLEGISSKYDIFVVFGLALASAMLLLTTFSVMALGAVVFTKRLLIGRYEPGVYD
WDKSPMCQRWQLLTAMEKLIHRCYVDKGILSLLTGTHWLVMYYRALGVKIGQDCSLFANGYPSLLITAADLVEIG
DRVVIDDVGLISHMDRKGSVRLDRIKIGHRCVLRSGSNVLYGATMRDESCLLEHTLILPGEVVKEKCTMQRRPAE
RFYGSRMGT
Coding >Ophio5|1301
ATGGATGAAGAGGACGAGAAGCATTCGGCTACCACGTTGGCCGTCACGTTGGACTGGTTCAGCAGCAGCAGCAGC
GGCGGTGGACACGACTCGCACGCACAGATGGAGAAGCAGGACGACTATCTCGACGACGACGGCTACCTCCGCGTC
ATGGGCGCCACAAAGGACATCATCCACTGCGACACACGGGACGTCGTTCCGGAGCAGGTGGAAGAGGCCATCATG
ACGGCGGGCGAAGCGCCCGACTCGCCCATTCACGGACGCATCGCCGCGGTGCTAGCCTTTGCCATCCAACACGAA
ACCCGAGGCGAGGCCGTAGCCGTCGTCCTCGTCCCCAGCCCAGACGTTCTCCGGGTCGACCTCCGGACCCTTCAC
GATGCCCTCAGGGCCTCACCTCTCGACAAAGGCCGGTGGCCGCAGGCCATCATCTACATGGACCGTCTGCCGCTT
CGTCGGGGCCGACCTCTACGGACCCGGCTTCGGATCCGGCTCGGTCTTCCGCGGCTGTCGGACCAGACGCCGTAC
GCGGCCCGGCATTGGGAGGCGACGTGTCCGGCGCCGGATACTTCGCTCATGAGGCCCATCGAGGTACTGAGATGT
CGCGTCGACGTCGACGCCATCACCACGACGCTGGCCTCTGTCGCCCCGAGTCATTTCATGGTCCATGTCGAGGAG
AGCCTGGAAGCGAGCGGCTACGACGTCTTCCTAGCTCCGGAGTCGCCCACGGCCGCGGGCTTGCTGCCACCCGGC
GGAGCGGAGCATTTCCGACGCCTCATGAACGCCTCTCTCATCGCCGAGGGCCATGCCGGACTCCCCGGCAACCTG
TACATCCTCGACGAACCGCTTCCGGTGGACGAGTGCGGTGCTCCGGACCGGGCCCGGCTGGCGGAGATGCAGACC
GAGCTCCGCAAGGACAGGCTGCCTACGCCGGTGCGACACGTCGAGGAACGGGTCGGGCGAGCGTTTGCCGAGGCG
CTCGATTGGCCTCACTCGCACGCTTCCTCCATCGACAAGGAAGCCGGCTTTTACCGGCTCGGCGGAGACGCTTCT
CGGGCCCAACGACTCCTGGCTTCGCTCCGAGTGGAATTCAACCTGCCGCTGCCGGCCAATCTGCTGTCTCCTCCC
CGGACGGGCTCCGTCGAGGCCGTGGCCGCTCTGATCGAGGCCCGGATGAGAGACGAACAGGCGGCCCCTCGCGGT
CACGGCTCTACCGAGACATACAGTTCGCGTAGAACGGGCCTGTTGCTGCTACAGCTTCTGCCCATCGTCTTCCTC
TACCCGCTCTACGTCTCTCTCGGAGCGACGTTGCAGCTCTACGTCCTGAGCAAGACTCGTTTCTGGCACAACGTC
GAAAGCCTCGGCGGACGTCTCTTCAACCTGATCCTCTCCCTCATCGCCTCCTGGGCCGCGCTGGAGATCATCTTT
CCCTGGGTCGGCATCGCGGCCAAATGGCTCATCATCGGTCGTTACCGCGAGGGCGTCTATCCCATGTGGGGGAGC
TATCATACTCGCTGGTGGATGGTGCAGAAGATCGTCATGGTCTGCGGCACCGGCTTCTTTGATATCAACGACCAC
GCCCGTAACGTCTATTACCGCCTCATGGGCGCTCGCATCGGTCACGACGTCCGTATCACCGACGTCTTTCTCGGC
GAGTGGGATCTGCTCGACATCCGTGACGGCGCCCGTCTTTCACGCTGTCACTGTCGACCCTTTGCTGCCGAGAAG
AACTCGTCCATGTATCTGAACCGCATCGTCATCGGCGAACGGTCCTCCATCGGCCTCAAGTCCGTCATCGCCCCG
GGAACCGAGGTGCTTCCGGATACCCGACTCGGAGCCAACTCGTCCAGCTGGGAGCAGGCCGATTCCTGGTCTGCT
GCCGCATCCTCCTCCCCCCATCATGACCGGGCCGGGGGGCCGGACGGAACTTGGCCGACGGCCGGGCCCAGCGCC
GTCCCGATCCCCGAGCCGCACTGGCTCCTGACGCTGTCCCTCACCGTGCCCATCTACCTCATCGGCTGGCTCATC
TCCATGCTTCCCTGGCTTCTCACCCTCGTTGGCATGCTTTACGAGCCGCCTCGGCACAGCACCATCCCCATCCGC
CTCATCCTCGACTGGTATCAGAGCAGCCCGGGCGTGGCCTACAACTACCTTTCCGTCGGCAGCAGCGTCGCCATC
TCGCCCATGCTCTTTTTCCTCTTCGCCATCTGCGTCCGCGCCATCTTCCGCCTCATCGTCGGTGATCCGCCTAGT
AGTCCGAGCGAGATCCGCAACTCGGTCGATGCCTGGCGAGTCGCTCTCATCCGCACCCTCTTCCCTGAGTCTCAG
ATGCTGGAGCTAAACGACATGATCGGTCACCACAACGAGGCTCGCTCCGCCGTTCTTCGTCTCCTGGGCGCCCGT
GTTGGCCAACGCGTCTGTTGGCCTACCGTCGGTCCCATTGTACGCGACTATCACCTGATTGATATCGGTGACGAC
GTCAGCTTTGGCGACAACTGTTTCCTCCAGACGTACGATGAGGGAGATTCCGGCGTCATCTCCATCGGCAACGGA
GCCGTCATCTCGGACCACGTCTGCGTCATGCCCGGCGTCTCCGTCGGCGAGCGCACCACCCTCGGCTTCGGCACT
TTGACCCGTCGCGGCCGCCATTACGAGTCCGGCAAGGCCTTCATCGGCGCAAGGGCCGGCGATGCCGCCCGTTCC
CATAGCATCGGCGGTGTCTTGTGGCCCGTCCCGGATGGCTCCGGCCGCCTCCTCCAAAGCCAAAGTTTAGTGACG
CTGGTCCCCTCCAACACCTCTTCGGCCGGCAACTCGTCCATACTCGAGAACTCGCCTTATAACCGCGCCGTCTAC
CTCAAGGACGCCCCCTACCGCGTCCTGTCGCCCACGACTACCCTCATCTTTTCCTTCTCCATGACTCTCTTCACC
ACCTTCTACTGGAACGTGGCAGCCCTCTCGTCCATGAAGGTCGCTTCCCGTATCTTCGTCCGCTATCTCGAGGGA
ATCAGCAGCAAGTACGACATCTTCGTAGTCTTTGGCCTCGCCTTAGCCAGCGCCATGCTCCTCCTCACCACCTTT
TCCGTCATGGCTCTTGGTGCCGTCGTCTTCACCAAGCGGCTGCTCATCGGCCGCTACGAACCCGGCGTCTACGAC
TGGGACAAATCCCCCATGTGCCAGCGGTGGCAGCTTCTGACGGCCATGGAGAAGCTGATCCACCGCTGCTACGTC
GATAAAGGCATTCTCAGCCTCTTGACGGGCACTCACTGGCTCGTCATGTACTATCGCGCCCTCGGCGTCAAGATC
GGCCAAGACTGTTCGCTCTTCGCCAACGGATATCCCAGCCTGCTCATCACCGCTGCCGATCTGGTGGAGATTGGC
GACCGCGTCGTCATTGACGATGTCGGTCTCATCTCCCACATGGACAGAAAGGGCAGCGTGCGTCTGGACCGCATC
AAGATCGGTCACCGCTGCGTGCTTCGCTCGGGGAGCAACGTCCTCTACGGCGCCACCATGCGGGACGAAAGCTGT
CTTCTGGAGCACACTCTCATTCTGCCAGGCGAGGTCGTCAAGGAGAAATGCACCATGCAGCGCCGTCCCGCCGAG
AGGTTCTACGGTTCCCGCATGGGGACG
Transcript >Ophio5|1301
ATGGATGAAGAGGACGAGAAGCATTCGGCTACCACGTTGGCCGTCACGTTGGACTGGTTCAGCAGCAGCAGCAGC
GGCGGTGGACACGACTCGCACGCACAGATGGAGAAGCAGGACGACTATCTCGACGACGACGGCTACCTCCGCGTC
ATGGGCGCCACAAAGGACATCATCCACTGCGACACACGGGACGTCGTTCCGGAGCAGGTGGAAGAGGCCATCATG
ACGGCGGGCGAAGCGCCCGACTCGCCCATTCACGGACGCATCGCCGCGGTGCTAGCCTTTGCCATCCAACACGAA
ACCCGAGGCGAGGCCGTAGCCGTCGTCCTCGTCCCCAGCCCAGACGTTCTCCGGGTCGACCTCCGGACCCTTCAC
GATGCCCTCAGGGCCTCACCTCTCGACAAAGGCCGGTGGCCGCAGGCCATCATCTACATGGACCGTCTGCCGCTT
CGTCGGGGCCGACCTCTACGGACCCGGCTTCGGATCCGGCTCGGTCTTCCGCGGCTGTCGGACCAGACGCCGTAC
GCGGCCCGGCATTGGGAGGCGACGTGTCCGGCGCCGGATACTTCGCTCATGAGGCCCATCGAGGTACTGAGATGT
CGCGTCGACGTCGACGCCATCACCACGACGCTGGCCTCTGTCGCCCCGAGTCATTTCATGGTCCATGTCGAGGAG
AGCCTGGAAGCGAGCGGCTACGACGTCTTCCTAGCTCCGGAGTCGCCCACGGCCGCGGGCTTGCTGCCACCCGGC
GGAGCGGAGCATTTCCGACGCCTCATGAACGCCTCTCTCATCGCCGAGGGCCATGCCGGACTCCCCGGCAACCTG
TACATCCTCGACGAACCGCTTCCGGTGGACGAGTGCGGTGCTCCGGACCGGGCCCGGCTGGCGGAGATGCAGACC
GAGCTCCGCAAGGACAGGCTGCCTACGCCGGTGCGACACGTCGAGGAACGGGTCGGGCGAGCGTTTGCCGAGGCG
CTCGATTGGCCTCACTCGCACGCTTCCTCCATCGACAAGGAAGCCGGCTTTTACCGGCTCGGCGGAGACGCTTCT
CGGGCCCAACGACTCCTGGCTTCGCTCCGAGTGGAATTCAACCTGCCGCTGCCGGCCAATCTGCTGTCTCCTCCC
CGGACGGGCTCCGTCGAGGCCGTGGCCGCTCTGATCGAGGCCCGGATGAGAGACGAACAGGCGGCCCCTCGCGGT
CACGGCTCTACCGAGACATACAGTTCGCGTAGAACGGGCCTGTTGCTGCTACAGCTTCTGCCCATCGTCTTCCTC
TACCCGCTCTACGTCTCTCTCGGAGCGACGTTGCAGCTCTACGTCCTGAGCAAGACTCGTTTCTGGCACAACGTC
GAAAGCCTCGGCGGACGTCTCTTCAACCTGATCCTCTCCCTCATCGCCTCCTGGGCCGCGCTGGAGATCATCTTT
CCCTGGGTCGGCATCGCGGCCAAATGGCTCATCATCGGTCGTTACCGCGAGGGCGTCTATCCCATGTGGGGGAGC
TATCATACTCGCTGGTGGATGGTGCAGAAGATCGTCATGGTCTGCGGCACCGGCTTCTTTGATATCAACGACCAC
GCCCGTAACGTCTATTACCGCCTCATGGGCGCTCGCATCGGTCACGACGTCCGTATCACCGACGTCTTTCTCGGC
GAGTGGGATCTGCTCGACATCCGTGACGGCGCCCGTCTTTCACGCTGTCACTGTCGACCCTTTGCTGCCGAGAAG
AACTCGTCCATGTATCTGAACCGCATCGTCATCGGCGAACGGTCCTCCATCGGCCTCAAGTCCGTCATCGCCCCG
GGAACCGAGGTGCTTCCGGATACCCGACTCGGAGCCAACTCGTCCAGCTGGGAGCAGGCCGATTCCTGGTCTGCT
GCCGCATCCTCCTCCCCCCATCATGACCGGGCCGGGGGGCCGGACGGAACTTGGCCGACGGCCGGGCCCAGCGCC
GTCCCGATCCCCGAGCCGCACTGGCTCCTGACGCTGTCCCTCACCGTGCCCATCTACCTCATCGGCTGGCTCATC
TCCATGCTTCCCTGGCTTCTCACCCTCGTTGGCATGCTTTACGAGCCGCCTCGGCACAGCACCATCCCCATCCGC
CTCATCCTCGACTGGTATCAGAGCAGCCCGGGCGTGGCCTACAACTACCTTTCCGTCGGCAGCAGCGTCGCCATC
TCGCCCATGCTCTTTTTCCTCTTCGCCATCTGCGTCCGCGCCATCTTCCGCCTCATCGTCGGTGATCCGCCTAGT
AGTCCGAGCGAGATCCGCAACTCGGTCGATGCCTGGCGAGTCGCTCTCATCCGCACCCTCTTCCCTGAGTCTCAG
ATGCTGGAGCTAAACGACATGATCGGTCACCACAACGAGGCTCGCTCCGCCGTTCTTCGTCTCCTGGGCGCCCGT
GTTGGCCAACGCGTCTGTTGGCCTACCGTCGGTCCCATTGTACGCGACTATCACCTGATTGATATCGGTGACGAC
GTCAGCTTTGGCGACAACTGTTTCCTCCAGACGTACGATGAGGGAGATTCCGGCGTCATCTCCATCGGCAACGGA
GCCGTCATCTCGGACCACGTCTGCGTCATGCCCGGCGTCTCCGTCGGCGAGCGCACCACCCTCGGCTTCGGCACT
TTGACCCGTCGCGGCCGCCATTACGAGTCCGGCAAGGCCTTCATCGGCGCAAGGGCCGGCGATGCCGCCCGTTCC
CATAGCATCGGCGGTGTCTTGTGGCCCGTCCCGGATGGCTCCGGCCGCCTCCTCCAAAGCCAAAGTTTAGTGACG
CTGGTCCCCTCCAACACCTCTTCGGCCGGCAACTCGTCCATACTCGAGAACTCGCCTTATAACCGCGCCGTCTAC
CTCAAGGACGCCCCCTACCGCGTCCTGTCGCCCACGACTACCCTCATCTTTTCCTTCTCCATGACTCTCTTCACC
ACCTTCTACTGGAACGTGGCAGCCCTCTCGTCCATGAAGGTCGCTTCCCGTATCTTCGTCCGCTATCTCGAGGGA
ATCAGCAGCAAGTACGACATCTTCGTAGTCTTTGGCCTCGCCTTAGCCAGCGCCATGCTCCTCCTCACCACCTTT
TCCGTCATGGCTCTTGGTGCCGTCGTCTTCACCAAGCGGCTGCTCATCGGCCGCTACGAACCCGGCGTCTACGAC
TGGGACAAATCCCCCATGTGCCAGCGGTGGCAGCTTCTGACGGCCATGGAGAAGCTGATCCACCGCTGCTACGTC
GATAAAGGCATTCTCAGCCTCTTGACGGGCACTCACTGGCTCGTCATGTACTATCGCGCCCTCGGCGTCAAGATC
GGCCAAGACTGTTCGCTCTTCGCCAACGGATATCCCAGCCTGCTCATCACCGCTGCCGATCTGGTGGAGATTGGC
GACCGCGTCGTCATTGACGATGTCGGTCTCATCTCCCACATGGACAGAAAGGGCAGCGTGCGTCTGGACCGCATC
AAGATCGGTCACCGCTGCGTGCTTCGCTCGGGGAGCAACGTCCTCTACGGCGCCACCATGCGGGACGAAAGCTGT
CTTCTGGAGCACACTCTCATTCTGCCAGGCGAGGTCGTCAAGGAGAAATGCACCATGCAGCGCCGTCCCGCCGAG
AGGTTCTACGGTTCCCGCATGGGGACGTAG
Gene >Ophio5|1301
ATGGATGAAGAGGACGAGAAGCATTCGGCTACCACGTTGGCCGTCACGTTGGACTGGTTCAGCAGCAGCAGCAGC
GGCGGTGGACACGACTCGCACGCACAGATGGAGAAGCAGGACGACTATCTCGACGACGACGGCTACCTCCGCGTC
ATGGGCGCCACAAAGGACATCATCCACTGCGACACACGGGACGTCGTTCCGGAGCAGGTGGAAGAGGCCATCATG
ACGGCGGGCGAAGCGCCCGACTCGCCCATTCACGGACGCATCGCCGCGGTGCTAGCCTTTGCCATCCAACACGAA
ACCCGAGGCGAGGCCGTAGCCGTCGTCCTCGTCCCCAGCCCAGACGTTCTCCGGGTCGACCTCCGGACCCTTCAC
GATGCCCTCAGGGCCTCACCTCTCGACAAAGGCCGGTGGCCGCAGGCCATCATCTACATGGACCGTCTGCCGCTT
CGTCGGGGCCGACCTCTACGGACCCGGCTTCGGATCCGGCTCGGTCTTCCGCGGCTGTCGGACCAGACGCCGTAC
GCGGCCCGGCATTGGGAGGCGACGTGTCCGGCGCCGGATACTTCGCTCATGAGGCCCATCGAGGTACTGAGATGT
CGCGTCGACGTCGACGCCATCACCACGACGCTGGCCTCTGTCGCCCCGAGTCATTTCATGGTCCATGTCGAGGAG
AGCCTGGAAGCGAGCGGCTACGACGTCTTCCTAGCTCCGGAGTCGCCCACGGCCGCGGGCTTGCTGCCACCCGGC
GGAGCGGAGCATTTCCGACGCCTCATGAACGCCTCTCTCATCGCCGAGGGCCATGCCGGACTCCCCGGCAACCTG
TACATCCTCGACGAACCGCTTCCGGTGGACGAGTGCGGTGCTCCGGACCGGGCCCGGCTGGCGGAGATGCAGACC
GAGCTCCGCAAGGACAGGCTGCCTACGCCGGTGCGACACGTCGAGGAACGGGTCGGGCGAGCGTTTGCCGAGGCG
CTCGATTGGCCTCACTCGCACGCTTCCTCCATCGACAAGGAAGCCGGCTTTTACCGGCTCGGCGGAGACGCTTCT
CGGGCCCAACGACTCCTGGCTTCGCTCCGAGTGGAATTCAACCTGCCGCTGCCGGCCAATCTGCTGTCTCCTCCC
CGGACGGGCTCCGTCGAGGCCGTGGCCGCTCTGATCGAGGCCCGGATGAGAGACGAACAGGCGGCCCCTCGCGGT
CACGGCTCTACCGAGACATACAGTTCGCGTAGAACGGGCCTGTTGCTGCTACAGCTTCTGCCCATCGTCTTCCTC
TACCCGCTCTACGTCTCTCTCGGAGCGACGTTGCAGCTCTACGTCCTGAGCAAGACTCGTTTCTGGCACAACGTC
GAAAGCCTCGGCGGACGTCTCTTCAACCTGATCCTCTCCCTCATCGCCTCCTGGGCCGCGCTGGAGATCATCTTT
CCCTGGGTCGGCATCGCGGCCAAATGGCTCATCATCGGTCGTTACCGCGAGGGCGTCTATCCCATGTGGGGGAGC
TATCATACTCGCTGGTGGATGGTGCAGAAGATCGTCATGGTCTGCGGCACCGGCTTCTTTGATATCAACGACCAC
GCCCGTAACGTCTATTACCGCCTCATGGGCGCTCGCATCGGTCACGACGTCCGTATCACCGACGTCTTTCTCGGC
GAGTGGGATCTGCTCGACATCCGTGACGGCGCCCGTCTTTCACGCTGTCACTGTCGACCCTTTGCTGCCGAGAAG
AACTCGTCCATGTATCTGAACCGCATCGTCATCGGCGAACGGTCCTCCATCGGCCTCAAGTCCGTCATCGCCCCG
GGAACCGAGGTGCTTCCGGATACCCGACTCGGAGCCAACTCGTCCAGCTGGGAGCAGGCCGATTCCTGGTCTGCT
GCCGCATCCTCCTCCCCCCATCATGACCGGGCCGGGGGGCCGGACGGAACTTGGCCGACGGCCGGGCCCAGCGCC
GTCCCGATCCCCGAGCCGCACTGGCTCCTGACGCTGTCCCTCACCGTGCCCATCTACCTCATCGGCTGGCTCATC
TCCATGCTTCCCTGGCTTCTCACCCTCGTTGGCATGCTTTACGAGCCGCCTCGGCACAGCACCATCCCCATCCGC
CTCATCCTCGACTGGTATCAGAGCAGCCCGGGCGTGGCCTACAACTACCTTTCCGTCGGCAGCAGCGTCGCCATC
TCGCCCATGCTCTTTTTCCTCTTCGCCATCTGCGTCCGCGCCATCTTCCGCCTCATCGTCGGTGATCCGCCTAGT
AGTCCGAGCGAGATCCGCAACTCGGTCGATGCCTGGCGAGTCGCTCTCATCCGCACCCTCTTCCCTGAGTCTCAG
ATGCTGGAGCTAAACGACATGATCGGTCACCACAACGAGGCTCGCTCCGCCGTTCTTCGTCTCCTGGGCGCCCGT
GTTGGCCAACGCGTCTGTTGGCCTACCGTCGGTCCCATTGTACGCGACTATCACCTGATTGATATCGGTGACGAC
GTCAGCTTTGGCGACAACTGTTTCCTCCAGACGTACGATGAGGGAGATTCCGGCGTCATCTCCATCGGCAACGGA
GCCGTCATCTCGGACCACGTCTGCGTCATGCCCGGCGTCTCCGTCGGCGAGCGCACCACCCTCGGCTTCGGCACT
TTGACCCGTCGCGGCCGCCATTACGAGTCCGGCAAGGCCTTCATCGGCGCAAGGGCCGGCGATGCCGCCCGTTCC
CATAGCATCGGCGGTGTCTTGTGGCCCGTCCCGGATGGCTCCGGCCGCCTCCTCCAAAGCCAAAGTTTAGTGACG
CTGGTCCCCTCCAACACCTCTTCGGCCGGCAACTCGTCCATACTCGAGAACTCGCCTTATAACCGCGCCGTCTAC
CTCAAGGACGCCCCCTACCGCGTCCTGTCGCCCACGACTACCCTCATCTTTTCCTTCTCCATGACTCTCTTCACC
ACCTTCTACTGGAACGTGGCAGCCCTCTCGTCCATGAAGGTCGCTTCCCGTATCTTCGTCCGCTATCTCGAGGGA
ATCAGCAGCAAGTACGACATCTTCGTAGTCTTTGGCCTCGCCTTAGCCAGCGCCATGCTCCTCCTCACCACCTTT
TCCGTCATGGCTCTTGGTGCCGTCGTCTTCACCAAGCGGCTGCTCATCGGCCGCTACGAACCCGGCGTCTACGAC
TGGGACAAATCCCCCATGTGCCAGCGGTGGCAGCTTCTGACGGCCATGGAGAAGCTGATCCACCGCTGCTACGTC
GATAAAGGCATTCTCAGCCTCTTGACGGGCACTCACTGGCTCGTCATGTACTATCGCGCCCTCGGCGTCAAGATC
GGCCAAGACTGTTCGCTCTTCGCCAACGGATATCCCAGCCTGCTCATCACCGCTGCCGATCTGGTGGAGATTGGC
GACCGCGTCGTCATTGACGATGTCGGTCTCATCTCCCACATGGACAGAAAGGGCAGCGTGCGTCTGGACCGCATC
AAGATCGGTCACCGCTGCGTGCTTCGCTCGGGGAGCAACGTCCTCTACGGCGCCACCATGCGGGACGAAAGCTGT
CTTCTGGAGCACACTCTCATTCTGCCAGGCGAGGTCGTCAAGGAGAAATGCACCATGCAGCGCCGTCCCGCCGAG
AGGTTCTACGGTTCCCGCATGGGGACGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail